IMP3 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: IMP3 Antibody [NBP2-56441] - Staining of human cell line HEK 293 shows localization to nucleus & nucleoli.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

IMP3 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: DFLNWEVTDHNLHELRVLRRYRLQRREDYTRYNQLSRAVRELARRLRDLPERDQFRVRASAALLDKLYALGLVPT
Specificity
Specificity of human IMP3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (96%), Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
IMP3
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
IMP3 Recombinant Protein Antigen (NBP2-56441PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, pH 7.2, containing 40% glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for IMP3 Antibody

  • BRMS2mitochondrial ribosomal protein S4
  • C15orf12
  • chromosome 15 open reading frame 12
  • FLJ10968
  • IMP3, U3 small nucleolar ribonucleoprotein, homolog (yeast)
  • MRPS4DKFZp586L0118
  • U3 small nucleolar ribonucleoprotein protein IMP3
  • U3 snoRNP protein 3 homolog
  • U3 snoRNP protein IMP3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-84339
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38956
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NBP2-02627
Species: Hu, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-32276
Species: Hu
Applications: WB, IP
AF7028
Species: Mu, Rt
Applications: WB, ICC
NBP1-87512
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-38232
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-55073
Species: Hu
Applications: WB, ICC/IF
NBP2-65558
Species: Hu
NBP2-55739
Species: Hu
Applications: ICC/IF
NBP2-68738
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP1-91705
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83107
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81591
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF5415
Species: Hu
Applications: WB, IHC, ICC

Publications for IMP3 Antibody (NBP2-56441) (0)

There are no publications for IMP3 Antibody (NBP2-56441).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IMP3 Antibody (NBP2-56441) (0)

There are no reviews for IMP3 Antibody (NBP2-56441). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for IMP3 Antibody (NBP2-56441) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for IMP3 Antibody (NBP2-56441)

Discover related pathways, diseases and genes to IMP3 Antibody (NBP2-56441). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IMP3 Antibody (NBP2-56441)

Discover more about diseases related to IMP3 Antibody (NBP2-56441).
 

Pathways for IMP3 Antibody (NBP2-56441)

View related products by pathway.

PTMs for IMP3 Antibody (NBP2-56441)

Learn more about PTMs related to IMP3 Antibody (NBP2-56441).

Blogs on IMP3

There are no specific blogs for IMP3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our IMP3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol IMP3