ILT5/CD85a/LILRB3 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

ILT5/CD85a/LILRB3 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ILT5/CD85a/LILRB3
  
  

  Source: E.coli

  Amino Acid Sequence: CHYYSSAGWSEPSDPLELVMTGFYNKPTLSALPSPVVASGGNMTLRCGSQKGYHHFVLMKEGEHQLPRTLDSQQLHSGGFQALFPVGPVTPSHRWRFTCYYYYTNTPWVWSHPSDPLEILPS

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: LILRB3
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10-100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-24915It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for ILT5/CD85a/LILRB3 Recombinant Protein Antigen

• CD85 antigen-like family member A
• CD85a antigen
• CD85a
• HL9Immunoglobulin-like transcript 5
• ILT5
• ILT-5
• ILT5CD85a
• Leukocyte immunoglobulin-like receptor 3
• leukocyte immunoglobulin-like receptor subfamily B member 3
• leukocyte immunoglobulin-like receptor, subfamily B (with TM and ITIM domains)
• LILRB3
• LIR3
• LIR3CD85A
• LIR-3MGC138403
• member 3
• Monocyte inhibitory receptor HL9
• PIRB

Background

LILRB3 is a 631 amino acid type I transmembrane glycoprotein, which contains four immunoreceptor tyrosine-based inhibition motif (ITIM) sequences within a long cytoplasmic tail. Phosphorylation of the tyrosine residues within ITIMs is known to enable the binding and activation of protein tyrosine phosphatases, which act as cell signaling modulators and inhibitors of cell activation. LILRB3 may act as receptor for class I MHC antigens.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: LILRB3