ILK Recombinant Protein Antigen

Images

 
There are currently no images for ILK Recombinant Protein Antigen (NBP2-55514PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

ILK Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ILK.

Source: E. coli

Amino Acid Sequence: DLVANGALVSICNKYGEMPVDKAKAPLRELLRERAEKMGQNLNRIPYKDTFWKGTTRTRPRNGTLNKHSGIDFKQLNFLTKLNENHSGELWKGRWQGNDIVVKVLKVRDWSTRKSRDFNEECPR

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ILK
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-55514.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for ILK Recombinant Protein Antigen

  • 59 kDa serine/threonine-protein kinase
  • DKFZp686F1765
  • EC 2.7.11.1
  • ESTM24
  • ILK
  • ILK1
  • ILK-1
  • ILK2
  • ILK-2
  • integrin-linked kinase
  • integrin-linked kinase-2
  • integrin-linked protein kinase
  • p59
  • p59ILK

Background

Integrin-linked kinase (ILK) is a key cytoplasmic plaque protein involved in the mediation of integrin functions. It plays a key role as a regulator during cell survival, cell proliferation, cell migration, and cell to cell adhesion (1). ILK links integrins to the actin cytoskeleton, allowing transduction of signals through integrins to the extracellular matrix (ECM). Also, ILK has been linked to the regulation of smooth contraction and cell motility in non-muscle cells through phosphorylation of myosin (2). Irregular activity level of ILK has been linked to expression of certain tumor. ILK overexpression caused by inactivating mutation in tumor suppressors (e.g. PTEN and APC) lead to tumor formation in transgenic mouse. Up-regulated ILK expression and activity are seen in Ewings scaromas, colorectal cancers, and late staged prostate cancers (3).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
MAB6210
Species: Hu
Applications: Simple Western, WB
MAB6257
Species: Hu, Mu, Rt
Applications: WB
NBP1-91258
Species: Bv, Ca, Eq, Fe, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
NBP2-67327
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, IP, WB
NBP2-46326
Species: Ca, Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
AF748
Species: Hu, Mu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, ICC, IHC, Simple Western, WB
AF4259
Species: Hu, Mu, Rt
Applications: ICC, Simple Western, WB
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
NB500-517
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, IP, WB
DYC1825-2
Species: Hu, Mu, Rt
Applications: ELISA
MAB17781
Species: Hu
Applications: Block, CyTOF-ready, Flow, ICC, IP, KO
NBP2-46327
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP2-15071
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KO, WB
NBP2-19804
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-46404
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P
DVE00
Species: Hu
Applications: ELISA
NBP1-83976
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NB100-807
Species: Hu
Applications: ICC/IF, PEP-ELISA, WB

Publications for ILK Recombinant Protein Antigen (NBP2-55514PEP) (0)

There are no publications for ILK Recombinant Protein Antigen (NBP2-55514PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ILK Recombinant Protein Antigen (NBP2-55514PEP) (0)

There are no reviews for ILK Recombinant Protein Antigen (NBP2-55514PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for ILK Recombinant Protein Antigen (NBP2-55514PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ILK Products

Research Areas for ILK Recombinant Protein Antigen (NBP2-55514PEP)

Find related products by research area.

Blogs on ILK.

Inhibitor kappa B-alpha (IkappaB-alpha)
The transcription factor nuclear factor kappa beta (NFkB) is highly regulated by triggers such as stress, free-radicals, UV light, and hypoxia. NFkB is one of the fastest responding transcription factors in humans. The NFKB signaling pathway is ess...  Read full blog post.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our ILK Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol ILK