ILF2 Antibody (1E2.)

Images

 
Sandwich ELISA: ILF2 Antibody (1E2) [H00003608-M01] - Detection limit for recombinant GST tagged ILF2 is approximately 1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
1E2.
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

ILF2 Antibody (1E2.) Summary

Immunogen
ILF2 (NP_004506, 151 a.a. - 250 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PSEVLTMLTNETGFEISSSDATVKILITTVPPNLRKLDPELHLDIKVLQSALAAIRHARWFEENASQSTVKVLIRLLKDLRIRFPGFEPLTPWILDLLGH
Localization
Nuclear
Specificity
ILF2 - interleukin enhancer binding factor 2, 45kDa
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ILF2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.
Publications
Read Publication using H00003608-M01.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ILF2 Antibody (1E2.)

  • interleukin enhancer binding factor 2, 45kD
  • interleukin enhancer binding factor 2, 45kDa
  • interleukin enhancer-binding factor 2
  • MGC8391
  • NF45PRO3063
  • Nuclear factor of activated T-cells 45 kDa
  • nuclear factor of activated T-cells, 45-kDa

Background

Nuclear factor of activated T-cells (NFAT) is a transcription factor required for T-cell expression of the interleukin 2 gene. NFAT binds to a sequence in the interleukin 2 gene enhancer known as the antigen receptor response element 2. In addition, NFAT can bind RNA and is an essential component for encapsidation and protein priming of hepatitis B viral polymerase. NFAT is a heterodimer of 45 kDa and 90 kDa proteins, the smaller of which is the product of this gene. The encoded protein binds strongly to the 90 kDa protein and stimulates its ability to enhance gene expression.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-84056
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-02456
Species: Hu, Mu
Applications: WB, ELISA, Flow, IHC, IHC-P
NBP1-77266
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IF
AF8519
Species: Hu, Mu, Rt
Applications: WB
NBP2-37583
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC
AF3235
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP1-83754
Species: Hu
Applications: IHC, IHC-P
NB110-40579
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00006607-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-41201
Species: Hu
Applications: WB, ChIP, ICC/IF, IHC, IP
NB120-11433
Species: Hu, Mu, Rt, Ye
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-18910
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-89606
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1915
Species: Hu, Mu, Rt, Ha, Pm, Xp
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NB120-3562
Species: Hu, Mu, Rt, Bv, Ch, Pm, Rb
Applications: WB, Flow, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP

Publications for ILF2 Antibody (H00003608-M01)(1)

Reviews for ILF2 Antibody (H00003608-M01) (0)

There are no reviews for ILF2 Antibody (H00003608-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ILF2 Antibody (H00003608-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ILF2 Products

Bioinformatics Tool for ILF2 Antibody (H00003608-M01)

Discover related pathways, diseases and genes to ILF2 Antibody (H00003608-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ILF2 Antibody (H00003608-M01)

Discover more about diseases related to ILF2 Antibody (H00003608-M01).
 

Pathways for ILF2 Antibody (H00003608-M01)

View related products by pathway.

PTMs for ILF2 Antibody (H00003608-M01)

Learn more about PTMs related to ILF2 Antibody (H00003608-M01).

Blogs on ILF2

There are no specific blogs for ILF2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ILF2 Antibody (1E2.) and receive a gift card or discount.

Bioinformatics

Gene Symbol ILF2
Entrez
OMIM
Uniprot