ILF1 Antibody (4A11)

Images

 
Western Blot: ILF1 Antibody (4A11) [H00003607-M04] - Analysis of FOXK2 expression in MCF-7.
Immunocytochemistry/ Immunofluorescence: ILF1 Antibody (4A11) [H00003607-M04] - Analysis of monoclonal antibody to FOXK2 on HeLa cell. Antibody concentration 10 ug/ml
Sandwich ELISA: ILF1 Antibody (4A11) [H00003607-M04] - Detection limit for recombinant GST tagged FOXK2 is 0.3 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
4A11
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

ILF1 Antibody (4A11) Summary

Immunogen
FOXK2 (NP_004505.2 561 a.a. - 660 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. QQAPLGQHQLPIKTVTQNGTHVASVPTAVHGQVNNAAASPLHMLATHASASASLPTKRHNGDQPEQPELKRIKTEDGEGIVIALSVDTPPAAVREKGVQN
Specificity
This product is specific for Human FOXK2 monoclonal antibody (M04), clone 4A11 [Gene ID: 3607].
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
FOXK2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ILF1 Antibody (4A11)

  • Cellular transcription factor ILF-1
  • forkhead box K2
  • forkhead box protein K2
  • FOXK1
  • ILF-1
  • ILF1ILF
  • interleukin enhancer binding factor 1
  • Interleukin enhancer-binding factor 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-2564
Species: Hu
Applications: WB
NBP2-01743
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00139628-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
H00283150-Q01
Species: Hu
NBP1-31348
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1793
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P, PEP-ELISA
NBP2-16521
Species: Hu, Mu
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
MAB1684
Species: Hu
Applications: WB
NB100-77417
Species: Mu
Applications: WB, Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vivo, CyTOF-ready
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP1-56594
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-84550
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-30961
Species: Hu
Applications: WB, ChIP, IHC, IHC-P
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC

Publications for ILF1 Antibody (H00003607-M04) (0)

There are no publications for ILF1 Antibody (H00003607-M04).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ILF1 Antibody (H00003607-M04) (0)

There are no reviews for ILF1 Antibody (H00003607-M04). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ILF1 Antibody (H00003607-M04) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ILF1 Products

Bioinformatics Tool for ILF1 Antibody (H00003607-M04)

Discover related pathways, diseases and genes to ILF1 Antibody (H00003607-M04). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ILF1 Antibody (H00003607-M04)

Discover more about diseases related to ILF1 Antibody (H00003607-M04).
 

Pathways for ILF1 Antibody (H00003607-M04)

View related products by pathway.

PTMs for ILF1 Antibody (H00003607-M04)

Learn more about PTMs related to ILF1 Antibody (H00003607-M04).
 

Research Areas for ILF1 Antibody (H00003607-M04)

Find related products by research area.

Blogs on ILF1

There are no specific blogs for ILF1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ILF1 Antibody (4A11) and receive a gift card or discount.

Bioinformatics

Gene Symbol FOXK2
Uniprot