IL-28R alpha/IFN-lambda R1 Antibody - BSA Free

Immunohistochemistry-Paraffin: IL-28R alpha/IFN-lambda R1 Antibody [NBP1-84381] - Staining of human small intestine shows membranous/cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: IL-28R alpha/IFN-lambda R1 Antibody [NBP1-84381] - Staining of human cervix, uterine shows moderate membranous/cytoplasmic positivity in squamous epithelial cells.

Immunohistochemistry-Paraffin: IL-28R alpha/IFN-lambda R1 Antibody [NBP1-84381] - Staining of human duodenum shows membranous/cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: IL-28R alpha/IFN-lambda R1 Antibody [NBP1-84381] - Staining of human fallopian tube shows moderate membranous/cytoplasmic positivity in glandular cells.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

IL-28R alpha/IFN-lambda R1 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: FEVEPAPPVLVLTQTEEILSANATYQLPPCMPPLDLKYEVAFWKEGAGNKTLFPVTPHGQPVQITLQPAASEHHCLSARTIYTFSVPKYSKFSKPTCFLLEVPEAN
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: IFNLR1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  IL-28R alpha/IFN-lambda R1 Recombinant Protein Antigen (NBP1-84381PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for IL-28R alpha/IFN-lambda R1 Antibody - BSA Free

• class II cytokine receptor CRF2/12
• CRF2/12
• CRF2-12
• Cytokine receptor class-II member 12
• Cytokine receptor family 2 member 12
• IFN-lambda R1
• IFN-lambda receptor 1
• IFN-lambda-R1
• IFNLR
• IFNLR1
• IL-28 R alpha
• IL-28 receptor subunit alpha
• IL28R alpha
• IL-28R1
• IL28RA
• IL-28Ra
• IL-28R-alpha
• Interferon lambda receptor 1
• interferon lambda, receptor 1
• interleukin 28 receptor A
• interleukin 28 receptor, alpha (interferon, lambda receptor)
• interleukin 28 receptor, alpha
• interleukin or cytokine receptor 2
• interleukin-28 receptor subunit alpha
• LICR2
• Likely interleukin or cytokine receptor 2

Background

IL28RA is a class II cytokine receptor that interacts with IL10RB to bind IL28A, IL28B, and IL29, which are related to type I interferons. These ligands play a critical role in response to microbial challenge and activate the JAK/STAT signaling system. It heterodimers with IL10RB. There are 4 isoforms as result of alternative splicing. It is widely expressed. IL28RA belongs to the type II cytokine receptor family, and contains 1 fibronectin type III domain.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for IL-28R alpha/IFN-lambda R1 Antibody (NBP1-84381)(3)

Publications using NBP1-84381

• Onabajo OO, Wang F, Lee MH et al. Intracellular Accumulation of IFN-?4 Induces ER Stress and Results in Anti-Cirrhotic but Pro-HCV Effects Frontiers in Immunology 2021-08-23 [PMID: 34497603]
• Apostolou E, Kapsogeorgou Ek, Konsta Od et al. Expression of Type-III interferons (IFNlambdas) and their receptor in Sjogren's Syndrome. Clin. Exp. Immunol. 2016-09-10 [PMID: 27613139] (IF/IHC)
• Zahn S et al. Evidence for a pathophysiological role of keratinocyte-derived type III interferon (IFNLambda) in cutaneous lupus erythematosus. J Invest Dermato 2011-01-01 [PMID: 20720564]

Bioinformatics

• Gene Symbol: IFNLR1
• Entrez:
  • 163702(Human)
• Uniprot:
  • Q8IU57(Human)