IL-28R alpha/IFN-lambda R1 Antibody - BSA Free

Western Blot: IL28RA Antibody [NBP1-69636] - This Anti-IL28RA antibody was used in Western Blot of HepG2 tissue lysate at a concentration of 1ug/ml.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

IL-28R alpha/IFN-lambda R1 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to IL28RA(interleukin 28 receptor, alpha (interferon, lambda receptor)) The peptide sequence was selected from the N terminal of IL28RA. Peptide sequence QDVTYFVAYQSSPTRRRWREVEECAGTKELLCSMMCLKKQDLYNKFKGRV. The peptide sequence for this immunogen was taken from within the described region.
• Specificity: This product is specific to Subunit or Isoform: alpha.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: IFNLR1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 58 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for IL-28R alpha/IFN-lambda R1 Antibody - BSA Free

• class II cytokine receptor CRF2/12
• CRF2/12
• CRF2-12
• Cytokine receptor class-II member 12
• Cytokine receptor family 2 member 12
• IFN-lambda R1
• IFN-lambda receptor 1
• IFN-lambda-R1
• IFNLR
• IFNLR1
• IL-28 R alpha
• IL-28 receptor subunit alpha
• IL28R alpha
• IL-28R1
• IL28RA
• IL-28Ra
• IL-28R-alpha
• Interferon lambda receptor 1
• interferon lambda, receptor 1
• interleukin 28 receptor A
• interleukin 28 receptor, alpha (interferon, lambda receptor)
• interleukin 28 receptor, alpha
• interleukin or cytokine receptor 2
• interleukin-28 receptor subunit alpha
• LICR2
• Likely interleukin or cytokine receptor 2

Background

IL28RA belongs to the class II cytokine receptor family. This protein forms a receptor complex with interleukine 10 receptor, beta (IL10RB). The receptor complex has been shown to interact with three closely related cytokines, including interleukin 28A (IL28A), interleukin 28B (IL28B), and interleukin 29 (IL29). The expression of all three cytokines can be induced by viral infection. The cells overexpressing this protein have been found to have enhanced responses to IL28A and IL29, but decreased response to IL28B.The protein encoded by this gene belongs to the class II cytokine receptor family. This protein forms a receptor complex with interleukine 10 receptor, beta (IL10RB). The receptor complex has been shown to interact with three closely related cytokines, including interleukin 28A (IL28A), interleukin 28B (IL28B), and interleukin 29 (IL29). The expression of all three cytokines can be induced by viral infection. The cells overexpressing this protein have been found to have enhanced responses to IL28A and IL29, but decreased response to IL28B. Three alternatively spliced transcript variants encoding distinct isoforms have been reported.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: IFNLR1
• Uniprot:
  • Q8IU57(Human)