IL-20 Antibody (2H8)

Images

 
Western Blot: IL-20 Antibody (2H8) [H00050604-M01] - IL20 monoclonal antibody (M01), clone 2H8 Analysis of IL20 expression in K-562.
Western Blot: IL-20 Antibody (2H8) [H00050604-M01] - IL20 monoclonal antibody (M01), clone 2H8. Analysis of IL20 expression in A-431.
Western Blot: IL-20 Antibody (2H8) [H00050604-M01] - Analysis of IL20 expression in transfected 293T cell line by IL20 monoclonal antibody (M01), clone 2H8.Lane 1: IL20 transfected lysate(20.1 KDa).Lane 2: ...read more
Immunoprecipitation: IL-20 Antibody (2H8) [H00050604-M01] - Analysis of IL20 transfected lysate using anti-IL20 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with IL20 MaxPab rabbit polyclonal ...read more
ELISA: IL-20 Antibody (2H8) [H00050604-M01] - Detection limit for recombinant GST tagged IL20 is approximately 0.3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IP
Clone
2H8
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

IL-20 Antibody (2H8) Summary

Immunogen
IL20 (NP_061194, 67 a.a. ~ 177 a.a) partial recombinant protein with GST tag.RTESLQDTKPANRCCLLRHLLRLYLDRVFKNYQTPDHYTLRK ISSLANSFLTIKKDLRLCHAHMTCHCGEEAMKKYSQILSHFE KLEPQAAVVKALGELDILLQWMEETE
Specificity
IL20 - interleukin 20
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
IL20
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
  • Immunoprecipitation 1:10-1:500
Application Notes
Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA.
Control
IL-20 Lysate (NBP2-66190)

Reactivity Notes

Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for IL-20 Antibody (2H8)

  • Cytokine Zcyto10
  • IL10D
  • IL20
  • IL-20
  • IL-20ZCYTO10four alpha helix cytokine
  • interleukin 20
  • interleukin-20
  • MGC96907

Background

The protein encoded by this gene is a cytokine structurally related to interleukin 10 (IL10). This cytokine has been shown to transduce its signal through signal transducer and activator of transcription 3 (STAT3) in keratinocytes. A specific receptor for this cytokine is found to be expressed in skin and upregulated dramatically in psoriatic skin, suggesting a role for this protein in epidermal function and psoriasis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-27327
Species: Hu
Applications: WB, IHC, IHC-P
2915-IL/CF
Species: Mu
2915-IL/CF
Species: Mu
MAB15041
Species: Hu
Applications: WB, IHC, CyTOF-ready, ICFlow
AF1375
Species: Hu
Applications: WB
7270-IL/CF
Species: Hu
NB100-56409
Species: Hu, Mu
Applications: WB, Flow
NBP2-22471
Species: Hu, Mu, Rt, Mk, Pm
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP, KD
AF874
Species: Hu
Applications: WB, Flow, CyTOF-ready, Neut
H00050604-M01
Species: Hu
Applications: WB, ELISA, IP

Publications for IL-20 Antibody (H00050604-M01) (0)

There are no publications for IL-20 Antibody (H00050604-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IL-20 Antibody (H00050604-M01) (0)

There are no reviews for IL-20 Antibody (H00050604-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for IL-20 Antibody (H00050604-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for IL-20 Antibody (H00050604-M01)

Discover related pathways, diseases and genes to IL-20 Antibody (H00050604-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IL-20 Antibody (H00050604-M01)

Discover more about diseases related to IL-20 Antibody (H00050604-M01).
 

Pathways for IL-20 Antibody (H00050604-M01)

View related products by pathway.

Research Areas for IL-20 Antibody (H00050604-M01)

Find related products by research area.

Blogs on IL-20

There are no specific blogs for IL-20, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our IL-20 Antibody (2H8) and receive a gift card or discount.

Bioinformatics

Gene Symbol IL20
Entrez
OMIM
Uniprot