IL-12 R beta 1 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

IL-12 R beta 1 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human IL-12 R beta 1.

  Source: E. coli

  Amino Acid Sequence: TSECCFQDPPYPDADSGSASGPRDLRCYRISSDRYECSWQYEGPTAGVSHFLRCCLSSGRCCYFAAGSATRLQFSDQAGVSVLYTVTLWVES

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: IL12RB1
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-57287.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 28 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for IL-12 R beta 1 Recombinant Protein Antigen

• CD212 antigen
• CD212
• IL-12 R beta 1
• IL-12 receptor beta component
• IL-12 receptor subunit beta-1
• IL12R beta 1
• IL-12R subunit beta-1
• IL12R
• IL12RB
• IL12RB1
• IL-12Rb1
• IL-12R-BETA1
• IL-12R-beta-1
• interleukin 12 receptor, beta 1
• interleukin-12 receptor beta-1 chain
• interleukin-12 receptor subunit beta-1
• MGC34454

Background

IL12RB1, also known as Interleukin-12 receptor subunit beta-1, has 3 isoforms, an isoform 1 that is 662 amino acid and 73 kDa, an isoform 2 that is 660 amino acid and 73 kDa, and an isoform3 that is 381 amino acid and 42 kDa; acts as an interleukin receptor which binds interleukin-12 with low affinity and is involved in IL12 transduction; forms a functional, high affinity receptor for IL12 when combined with IL12RB2, and associates also with IL23R to form the interleukin-23 receptor which plays a role in IL23 signal transduction probably through activation of the Jak-Stat signaling cascade. Current research is being pursued on this protein involvement in several diseases and disorders including immunodeficiency, mycobacterial and salmonella infections, salmonella gastroenteritis, mycobacterium infectious disease, myocarditis, lupus erythematosus, tuberculosis, sarcoidosis, neurological disorder, rheumatoid arthritis, gastroenteritis, asthma, and dermatitis. IL12RB1 protein involvement has been observed with relation to IL23R, IL23A, IL12A, IL12B, and IL12RB2 in the immune response IL-12 signaling pathway, immune response IL-22 signaling pathway, immune response IL-12-induced IFN-gamma production, cytokine production by Th17 cells in CF, and Jak-STAT signaling pathway.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: IL12RB1