IL-12 R beta 1 Antibody Summary
| Immunogen |
IL12RB1 (AAH29121, 1 a.a. - 381 a.a.) full-length human protein. MEPLVTWVVPLLFLFLLPRQGAACRTSECCFQDPPYPDADSGSASGPRDLRCYRISSDRYECSWQYEGPTAGVSHFLRCCLSSGRCCYFAAGSATRLQFSDQAGVSVLYTVTLWVESWARNQTEKSPEVTLQLYNSVKYEPPLGDIKVSKLAGQLRMEWETPDNQVGAEVQFRHRTPSSPWKLGDCGPQDDDTESCLCPLEMNVAQEFQLRRRRLGSQGSSWSKWSSPVCVPPENPPQPQVRFSVEQLGQDGRRRLTLKEQPTQLELPEGCQGLAPGTEVTYRLQLHMLSCPCKAKATRTLHLGKMPYLSGAAYNVAVISSNQFGPGLNQTWHIPADTHTDGMISAHCNLRLPDSRDSPASASRVAGITGICHHTRLILYF |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Mouse |
| Gene |
IL12RB1 |
| Purity |
Immunogen affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.4) |
| Preservative |
No Preservative |
| Purity |
Immunogen affinity purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for IL-12 R beta 1 Antibody
Background
IL12RB1, also known as Interleukin-12 receptor subunit beta-1, has 3 isoforms, an isoform 1 that is 662 amino acid and 73 kDa, an isoform 2 that is 660 amino acid and 73 kDa, and an isoform3 that is 381 amino acid and 42 kDa; acts as an interleukin receptor which binds interleukin-12 with low affinity and is involved in IL12 transduction; forms a functional, high affinity receptor for IL12 when combined with IL12RB2, and associates also with IL23R to form the interleukin-23 receptor which plays a role in IL23 signal transduction probably through activation of the Jak-Stat signaling cascade. Current research is being pursued on this protein involvement in several diseases and disorders including immunodeficiency, mycobacterial and salmonella infections, salmonella gastroenteritis, mycobacterium infectious disease, myocarditis, lupus erythematosus, tuberculosis, sarcoidosis, neurological disorder, rheumatoid arthritis, gastroenteritis, asthma, and dermatitis. IL12RB1 protein involvement has been observed with relation to IL23R, IL23A, IL12A, IL12B, and IL12RB2 in the immune response IL-12 signaling pathway, immune response IL-22 signaling pathway, immune response IL-12-induced IFN-gamma production, cytokine production by Th17 cells in CF, and Jak-STAT signaling pathway.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Mu
Applications: BA
Species: Hu
Applications: WB
Species: Hu
Applications: BA
Species: Mu
Applications: ELISA
Species: Hu, Mu
Applications: CyTOF-ready, ICFlow, Simple Western, WB
Species: Hu
Applications: CyTOF-ready, Flow, Neut, WB
Species: Hu
Applications: WB
Species: Mu
Applications: ELISA
Species: Hu
Applications: BA
Species: Mu
Applications: ELISA
Species: Hu
Applications: ELISA
Species: Hu
Applications: CyTOF-ready, Flow, Neut, WB
Species: Mu
Applications: Neut, WB
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Mu
Applications: BA
Species: Hu, Mu, Rt
Applications: ICC, IP, ICFlow, KO, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: B/N, Func-Inh, In vitro, In vivo
Species: Hu
Applications: WB
Publications for IL-12 R beta 1 Antibody (H00003594-B01P-50ug) (0)
There are no publications for IL-12 R beta 1 Antibody (H00003594-B01P-50ug).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for IL-12 R beta 1 Antibody (H00003594-B01P-50ug) (0)
There are no reviews for IL-12 R beta 1 Antibody (H00003594-B01P-50ug).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for IL-12 R beta 1 Antibody (H00003594-B01P-50ug) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional IL-12 R beta 1 Products
Array H00003594-B01P-50ug
Research Areas for IL-12 R beta 1 Antibody (H00003594-B01P-50ug)
Find related products by research area.
|
Blogs on IL-12 R beta 1