IL-10 R beta Antibody Summary
Description |
Quality control test: Antibody reactive against mammalian transfected lysate. |
Immunogen |
IL10RB (AAH01903.1, 1 a.a. - 325 a.a.) full-length human protein. MAWSLGSWLGGCLLVSALGMVPPPENVRMNSVNFKNILQWESPAFAKGNLTFTAQYLSYRIFQDKCMNTTLTECDFSSLSKYGDHTLRVRAEFADEHSDWVNITFCPVDDTIIGPPGMQVEVLADSLHMRFLAPKIENEYETWTMKNVYNSWTYNVQYWKNGTDEKFQITPQYDFEVLRNLEPWTTYCVQVRGFLPDRNKAGEWSEPVCEQTTHDETVPSWMVAVILMASVFMVCLALLGCFALLWCVYKKTKYAFSPRNSLPQHLKEFLGHPHHNTLLFFSFPLSDENDVFDKLSVIAEDSESGKQNPGDSCSLGTPPGQGPQS |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
IL10RB |
Purity |
Protein G purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
|
Application Notes |
It has been used for WB and Functional. |
Packaging, Storage & Formulations
Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.4) |
Preservative |
No Preservative |
Purity |
Protein G purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for IL-10 R beta Antibody
Background
IL10RB, also known as Interleukin-10 receptor subunit beta, is a 325 amino acid protein that is 37 kDa; belongs to the type II cytokine receptor family; cell surface receptor required for the activation of five class 2 cytokines: IL10, IL22, IL26, IL28, and IL29; and its co-expression with IL10RA proteins is needed for IL10-induced signal transduction. This protein is currently being studied for research on several diseases and disorders including inflammatory bowel disease 25, early onset, autosomal recessive, hepatitis b virus, inflammatory bowel disease, hepatitis b, interferon, respiratory syncytial virus bronchiolitis, graft versus host disease, ulcerative colitis crohn's disease, anaplastic large cell lymphoma, secondary hyperparathyroidism, mumps, systemic lupus erythematosus, measles, bronchiolitis, rubella, cblc, lupus erythematosus, rheumatoid arthritis, colitis, and tumors. Interactions with IL10RB have been shown to involve IL22, UCN3, IL10RA, IL28A, and IL10 in cytokine-cytokine receptor interaction, Jak-STAT signaling pathway, toxoplasmosis, tuberculosis, antioxidant action of vitamin-C, immune response IL-22 signaling pathway, and molecular mechanisms of cancer pathway.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Mu
Applications: ELISA
Species: Hu
Applications: BA
Species: Hu
Applications: CyTOF-ready, IHC, ICFlow, WB
Species: Hu
Applications: Neut
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: ICC, IP, ICFlow, KO, WB
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Mu
Applications: Block, CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), ICFlow, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ELISA
Species: Hu, Mu
Applications: CyTOF-ready, ICFlow, Simple Western, WB
Species: Hu, Mu
Applications: WB
Species: Hu
Applications: CyTOF-ready, Flow, WB
Species: Hu
Applications: IHC
Species: Hu
Applications: BA
Publications for IL-10 R beta Antibody (H00003588-D01P) (0)
There are no publications for IL-10 R beta Antibody (H00003588-D01P).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for IL-10 R beta Antibody (H00003588-D01P) (0)
There are no reviews for IL-10 R beta Antibody (H00003588-D01P).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for IL-10 R beta Antibody (H00003588-D01P) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional IL-10 R beta Products
Research Areas for IL-10 R beta Antibody (H00003588-D01P)
Find related products by research area.
|
Blogs on IL-10 R beta