IL-10 R beta Antibody

Images

 
Western Blot: IL-10 R beta Antibody [H00003588-B02P] - Analysis of IL10RB expression in transfected 293T cell line by IL10RB polyclonal antibody. Lane 1: IL10RB transfected lysate(37.00 KDa). Lane 2: Non-transfected ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

IL-10 R beta Antibody Summary

Immunogen
IL10RB (NP_000619.3, 1 a.a. - 325 a.a.) full-length human protein. MAWSLGSWLGGCLLVSALGMVPPPENVRMNSVNFKNILQWESPAFAKGNLTFTAQYLSYRIFQDKCMNTTLTECDFSSLSKYGDHTLRVRAEFADEHSDWVNITFCPVDDTIIGPPGMQVEVLADSLHMRFLAPKIENEYETWTMKNVYNSWTYNVQYWKNGTDEKFQITPQYDFEVLRNLEPWTTYCVQVRGFLPDRNKAGEWSEPVCEQTTHDETVPSWMVAVILMASVFMVCLALLGCFALLWCVYKKTKYAFSPRNSLPQHLKEFLGHPHHNTLLFFSFPLSDENDVFDKLSVIAEDSESGKQNPGDSCSLGTPPGQGPQS
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
IL10RB
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
It has been used for WB.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein G purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for IL-10 R beta Antibody

  • CDw210b antigen
  • CDw210b
  • CRF2-4IL-10R subunit 2
  • CRFB4
  • CRFB4human transmembrane receptor protein; cytokine receptor10CDW210B
  • D21S58
  • D21S66
  • IBD25
  • IL-10 R beta
  • IL-10 receptor subunit beta
  • IL10R beta
  • IL-10R2
  • IL-10R2IL-10R subunit beta
  • IL10RB
  • IL-10Rb
  • interleukin 10 receptor, beta
  • Interleukin-10 receptor subunit 2
  • interleukin-10 receptor subunit beta
  • member 4

Background

The protein encoded by this gene belongs to the cytokine receptor family. It is an accessory chain essential for the active interleukin 10 receptor complex. Coexpression of this and IL10RA proteins has been shown to be required for IL10-induced signal transduction. This gene and three other interferon receptor genes, IFAR2, IFNAR1, and IFNGR2, form a class II cytokine receptor gene cluster located in a small region on chromosome 21.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB15041
Species: Hu
Applications: WB, IHC, CyTOF-ready, ICFlow
MAB274
Species: Hu
Applications: Neut
AF1375
Species: Hu
Applications: WB
NBP2-22471
Species: Hu, Mu, Rt, Mk, Pm
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
NBP1-85455
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF1709
Species: Mu
Applications: WB, Block, CyTOF-ready, ELISA(Cap), ELISA(Det), ICFlow, ELISA(Sta)
1102-IL/CF
Species: Hu
AF2894
Species: Hu, Mu
Applications: WB, Simple Western, CyTOF-ready, ICFlow
NBP2-27210
Species: Hu, Fe, Pm
Applications: WB, IHC-P
AF245
Species: Hu
Applications: WB, Flow, CyTOF-ready
NB100-56409
Species: Hu, Mu
Applications: WB, Flow

Publications for IL-10 R beta Antibody (H00003588-B02P) (0)

There are no publications for IL-10 R beta Antibody (H00003588-B02P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IL-10 R beta Antibody (H00003588-B02P) (0)

There are no reviews for IL-10 R beta Antibody (H00003588-B02P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for IL-10 R beta Antibody (H00003588-B02P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional IL-10 R beta Products

Bioinformatics Tool for IL-10 R beta Antibody (H00003588-B02P)

Discover related pathways, diseases and genes to IL-10 R beta Antibody (H00003588-B02P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IL-10 R beta Antibody (H00003588-B02P)

Discover more about diseases related to IL-10 R beta Antibody (H00003588-B02P).
 

Pathways for IL-10 R beta Antibody (H00003588-B02P)

View related products by pathway.

PTMs for IL-10 R beta Antibody (H00003588-B02P)

Learn more about PTMs related to IL-10 R beta Antibody (H00003588-B02P).
 

Research Areas for IL-10 R beta Antibody (H00003588-B02P)

Find related products by research area.

Blogs on IL-10 R beta

There are no specific blogs for IL-10 R beta, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our IL-10 R beta Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol IL10RB
Entrez
Uniprot