Recombinant Human IL1RAPL1 GST (N-Term) Protein

SDS-Page: Recombinant Human IL-1 RAPL1/IL-1 R8 Protein [H00011141-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Discontinued

Recombinant Human IL1RAPL1 GST (N-Term) Protein Summary

• Description: A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 151-250 of Human IL-1 RAPL1/IL-1 R8
  
  

  Source: Wheat Germ (in vitro)

  Amino Acid Sequence: FEKAELSKSKEISCRDIEDFLLPTREPEILWYKECRTKTWRPSIVFKRDTLLIREVREDDIGNYTCELKYGGFVVRRTTELTVTAPLTDKPPKLLYPMES

• Preparation Method: in vitro wheat germ expression system
• Details of Functionality: This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
• Source: Wheat germ
• Protein/Peptide Type: Partial Recombinant Protein
• Gene: IL1RAPL1
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • SDS-Page
  • Western Blot
• Theoretical MW: 36.74 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -80C. Avoid freeze-thaw cycles.
• Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human IL1RAPL1 GST (N-Term) Protein

• IL1R8IL1RAPL
• IL-1R9
• IL1RAPL1
• IL-1RAPL1
• IL-1-RAPL-1
• IL-1RAPL-1
• IL1RAPL-1
• interleukin 1 receptor accessory protein-like 1
• interleukin 1 receptor-8
• interleukin-1 receptor accessory protein-like 1
• mental retardation, X-linked 10
• MRX10
• MRX21
• MRX34
• oligophrenin-4
• OPHN4mental retardation, X-linked 21
• Three immunoglobulin domain-containing IL-1 receptor-related 2
• TIGIRR-2
• TIGIRR-2mental retardation, X-linked 34
• X-linked interleukin-1 receptor accessory protein-like 1

Background

IL1RAPL1 is encoded by this gene is a member of the interleukin 1 receptor family and is similar to the interleukin 1 accessory proteins. It is most closely related to interleukin 1 receptor accessory protein-like 2 (IL1RAPL2). This gene and IL1RAPL2 are located at a region on chromosome X that is associated with X-linked non-syndromic mental retardation. Deletions and mutations in this gene were found in patients with mental retardation. This gene is expressed at a high level in post-natal brain structures involved in the hippocampal memory system, which suggests a specialized role in the physiological processes underlying memory and learning abilities.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: IL1RAPL1