IKK alpha Recombinant Protein Antigen

Images

 
There are currently no images for IKK alpha Protein (NBP1-89634PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

IKK alpha Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CHUK.

Source: E. coli

Amino Acid Sequence: HTVQSQDRVLKELFGHLSKLLGCKQKIIDLLPKVEVALSNIKEADNTVMFMQGKRQKEIWHLLKIACTQSSARSLVGSSLEGAVTPQTSAWLPPTSAEHDHSLSCVVTPQDGETSAQMIEENLNCLGHLSTIIHEANEEQGNSMMN

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CHUK
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-89634.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
34 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for IKK alpha Recombinant Protein Antigen

  • CHUK
  • conserved helix-loop-helix ubiquitous kinaseIKBKA
  • EC 2.7.11
  • EC 2.7.11.10
  • I-kappa-B kinase 1
  • I-kappa-B kinase alpha
  • IkappaB kinase
  • IkBKA
  • IkBKalpha
  • IKK alpha
  • IKK1
  • IKK1I-kappa-B kinase-alpha
  • IKK-A
  • IKKAIkB kinase alpha subunit
  • IKK-alphainhibitor of nuclear factor kappa-B kinase subunit alpha
  • NFKBIKA
  • NFKBIKAIKK-a kinase
  • Nuclear factor NFkappaB inhibitor kinase alpha
  • Nuclear factor NF-kappa-B inhibitor kinase alpha
  • TCF16
  • TCF-16
  • Transcription factor 16

Background

IKK-alpha (I-Kappa-B kinase-alpha) is a member of the IKK complex which is composed of IKK-alpha, IKK-beta, IKK-gamma and IKAP (1-2). Phosphorylation of I-Kappa-B on a serine residue by the IKK complex frees NF-kB from I-Kappa-B and marks it for degradation via ubiquination. Activation of NFKB by TNF requires phosphorylation of IKK-alpha at threonine 23 and serine 176 by AKT1 and NIK respectively (3). It has been demonstrated that IKK-alpha can accumulate in the nucleus after cytokine exposure (4). In the nucleus IKK-alpha interacts with CREB-binding protein in conjunction with RELA to be recruited to the NF-kappa-B-responsive promoters in order to mediate the cytokine-induced phosphorylation and subsequent acetylation of specific residues in histone H3 (5).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56509
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, IB, ICC/IF, IHC,  IHC-P, IP, Simple Western, WB
MAB3199
Species: Hu, Mu, Rt
Applications: ICC, WB
NB100-56583
Species: Hu, Rb, Rt
Applications: Flow, IHC,  IHC-P, KO, Simple Western, WB
NB100-56507
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC/IF, IHC,  IHC-P, IP, KO, Simple Western, WB
NB100-2176
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC,  IHC-P, IP, WB
NBP2-26504
Species: Hu, Mu, Rt
Applications: B/N, Func-Inh, In vitro, In vivo
MAB4364
Species: Rt
Applications: ICC, IHC, IP, KO, WB
AF2849
Species: Mu, Rt
Applications: WB
NBP2-02665
Species: Ca, Hu, Pm, Po, Pm, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-67471
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
NBP2-23603
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-58853
Species: Hu
Applications: IHC,  IHC-P, WB
MAB3277
Species: Hu, Mu, Rt
Applications: ICC, KO, WB
MAB17761
Species: Hu, Mu, Rt
Applications: ICC, WB
M6000B
Species: Mu
Applications: ELISA
AF632
Species: Hu
Applications: AgAct, Simple Western, WB
NBP1-89634PEP
Species: Hu
Applications: AC

Publications for IKK alpha Protein (NBP1-89634PEP) (0)

There are no publications for IKK alpha Protein (NBP1-89634PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IKK alpha Protein (NBP1-89634PEP) (0)

There are no reviews for IKK alpha Protein (NBP1-89634PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for IKK alpha Protein (NBP1-89634PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional IKK alpha Products

Research Areas for IKK alpha Protein (NBP1-89634PEP)

Find related products by research area.

Blogs on IKK alpha.

IKK alpha says "no" to NFk beta
The nuclear factor kappa B (NFkB) is a ubiquitous transcription factor essential for the activation of immune and inflammatory responses. NFkB activity is inhibited when it is associated with IkB proteins in the cell cytoplasm. IkB proteins are phosph...  Read full blog post.

Regulating Immune Response Pathways with IKK beta
IKK beta, also known as IKK2, activates the NFkB complex by phosphorylating the NFkB inhibitor, IkBa. Several transcript variants, some protein-coding and some not, have been found for IKKB. The Nuclear Factor-kappa B (NF-kB) family of transcription f...  Read full blog post.

IKK alpha: Roles in Development, B-cell Survival and ESC Differentiation
Inhibitor of nuclear factor kappa-B kinase subunit alpha (IKK1 alpha) is a serine/threonine kinase that forms a complex with IKK beta and NEMO. It plays an essential role in embryonic skin development. Mice with low levels of IKKa show an increase in ...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our IKK alpha Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol CHUK