IkB-beta Recombinant Protein Antigen

Images

 
There are currently no images for IkB-beta Recombinant Protein Antigen (NBP2-57108PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

IkB-beta Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human IkB-beta.

Source: E. coli

Amino Acid Sequence: EEDWKLQLEAENYEGHTPLHVAVIHKDVEMVRLLRDAGADLDKPEPTCGRSPLHLAVEAQAADVL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
NFKBIB
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-57108.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for IkB-beta Recombinant Protein Antigen

  • beta
  • IkappaBbeta
  • I-kappa-B-beta
  • ikB-B
  • IkBbeta
  • IkB-beta
  • IKBBikB-beta
  • NF-kappa-B inhibitor beta
  • NF-kappa-BIB
  • NFKBIB
  • nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor
  • Thyroid receptor-interacting protein 9
  • TR-interacting protein 9
  • TRIP-9
  • TRIP9ikappaBbeta

Background

NFKB1 (MIM 164011) or NFKB2 (MIM 164012) is bound to REL (MIM 164910), RELA (MIM 164014), or RELB (MIM 604758) to form the NFKB complex. The NFKB complex is inhibited by I-kappa-B proteins (NFKBIA, MIM 164008, or NFKBIB), which inactivate NF-kappa-B by trapping it in the cytoplasm. Phosphorylation of serine residues on the I-kappa-B proteins by kinases (IKBKA, MIM 600664 or IKBKB, MIM 603258) marks them for destruction via the ubiquitination pathway, thereby allowing activation of the NF-kappa-B complex. Activated NFKB complex translocates into the nucleus and binds DNA at kappa-B-binding motifs such as 5-prime GGGRNNYYCC 3-prime or 5-prime HGGARNYYCC 3-prime (where H is A, C, or T; R is an A or G purine; and Y is a C or T pyrimidine).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56583
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, Simple Western, WB
NB100-56507
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P, IP, KO, Simple Western, WB
NBP2-29661
Species: Hu, Mu, Rt
Applications: ELISA
AF2849
Species: Mu, Rt
Applications: WB
NBP2-02665
Species: Ca, Hu, Pm, Po, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
MAB4364
Species: Rt
Applications: ICC, IHC, IP, KO, WB
AF2699
Species: Mu
Applications: Simple Western, WB
AF632
Species: Hu
Applications: AgAct, Simple Western, WB
NBP1-88650
Species: Hu
Applications: IHC, IHC-P, KD, WB
NBP2-01345
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-87762
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB100-56509
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, IB, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
NB100-56704
Species: Hu, Mu, Pm, Rt
Applications: ChIP, ChIP, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
DCP00
Species: Hu
Applications: ELISA
NB300-605
Species: Hu, Mu, Po, Rt
Applications: Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, WB
MAB8930
Species: Hu
Applications: ICC, Simple Western, WB
MAB3199
Species: Hu, Mu, Rt
Applications: ICC, WB
NBP1-87760
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, Simple Western, WB
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB

Publications for IkB-beta Recombinant Protein Antigen (NBP2-57108PEP) (0)

There are no publications for IkB-beta Recombinant Protein Antigen (NBP2-57108PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IkB-beta Recombinant Protein Antigen (NBP2-57108PEP) (0)

There are no reviews for IkB-beta Recombinant Protein Antigen (NBP2-57108PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for IkB-beta Recombinant Protein Antigen (NBP2-57108PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional IkB-beta Products

Research Areas for IkB-beta Recombinant Protein Antigen (NBP2-57108PEP)

Find related products by research area.

Blogs on IkB-beta

There are no specific blogs for IkB-beta, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our IkB-beta Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol NFKBIB