Ikaros/IKZF1 Recombinant Protein Antigen

Images

 
There are currently no images for Ikaros/IKZF1 Protein (NBP2-38242PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Ikaros/IKZF1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human IKZF1.

Source: E. coli

Amino Acid Sequence: DADEGQDMSQVSGKESPPVSDTPDEGDEPMPIPEDLSTTSGGQQSSKSDRVVASNVKVETQSDEENGRACEMNGEECAEDLRMLDASGEKMNGSH

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
IKZF1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-38242.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Ikaros/IKZF1 Recombinant Protein Antigen

  • DNA-binding protein Ikaros
  • hIk-1
  • IK1
  • IK1LyF-1
  • Ikaros (zinc finger protein)
  • IKAROS family zinc finger 1 (Ikaros)
  • Ikaros family zinc finger protein 1
  • Ikaros
  • IKAROSLymphoid transcription factor LyF-1
  • IKZF1
  • LYF1
  • LyF-1
  • LYF1PRO0758
  • PRO0758
  • zinc finger protein, subfamily 1A, 1 (Ikaros)
  • ZNFN1A1
  • ZNFN1A1CLL-associated antigen KW-6

Background

Transcription regulator of hematopoietic cell differentiation. Binds gamma-satellite DNA. Binds with higher affinity to gamma satellite A. Plays a role in the development of lymphocytes, B- and T-cells. Binds and activates the enhancer (delta-A element) of the CD3-delta gene. Repressor of the TDT (terminal deoxynucleotidyltransferase) gene during thymocyte differentiation. Regulates transcription through association with both HDAC-dependent and HDAC-independent complexes. Targets the 2 chromatin-remodeling complexes, NuRD and BAF (SWI/SNF), in a single complex (PYR complex), to the beta-globin locus in adult erythrocytes. Increases normal apoptosis in adult erythroid cells. Confers early temporal competence to retinal progenitor cells (RPCs)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-20119
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
NBP2-24495
Species: Hu, Pm
Applications: ICC/IF, IHC, WB
MAB73091
Species: Hu
Applications: IHC, WB
MAB3487
Species: Hu, Mu
Applications: Flow, ICC, IHC, mIF, Simple Western, WB
NBP2-59451
Species: Hu
Applications: ELISA, Flow, ICC/IF, MiAr, Simple Western, WB
MAB7650
Species: Mu
Applications: IHC, WB
NBP2-33694
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
AF5165
Species: Hu, Mu
Applications: WB
NBP2-12900
Species: Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, MiAr, Simple Western, WB
NBP1-19371
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
NBP2-27163
Species: Bv, Ca, Eq, Hu, Mu, Pm
Applications: Flow, WB
NBP1-47492
Species: Pm, Hu
Applications: ChIP, ELISA, ICC/IF, IHC,  IHC-P, WB
AF4117
Species: Rt
Applications: IHC, WB
NB200-106
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP2-31368
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
MAB812
Species: Hu
Applications: CyTOF-ready, Flow
NB100-56104
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-Fr,  IHC-P, IP, WB
AF5129
Species: Hu
Applications: WB

Publications for Ikaros/IKZF1 Protein (NBP2-38242PEP) (0)

There are no publications for Ikaros/IKZF1 Protein (NBP2-38242PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Ikaros/IKZF1 Protein (NBP2-38242PEP) (0)

There are no reviews for Ikaros/IKZF1 Protein (NBP2-38242PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Ikaros/IKZF1 Protein (NBP2-38242PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Ikaros/IKZF1 Products

Research Areas for Ikaros/IKZF1 Protein (NBP2-38242PEP)

Find related products by research area.

Blogs on Ikaros/IKZF1

There are no specific blogs for Ikaros/IKZF1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Ikaros/IKZF1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol IKZF1