Ikaros/IKZF1 Recombinant Protein Antigen

Images

 
There are currently no images for Ikaros/IKZF1 Protein (NBP2-38242PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Ikaros/IKZF1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human IKZF1.

Source: E.coli

Amino Acid Sequence: DADEGQDMSQVSGKESPPVSDTPDEGDEPMPIPEDLSTTSGGQQSSKSDRVVASNVKVETQSDEENGRACEMNGEECAEDLRMLDASGEKMNGSH

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
IKZF1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-38242.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for Ikaros/IKZF1 Recombinant Protein Antigen

  • DNA-binding protein Ikaros
  • hIk-1
  • IK1
  • IK1LyF-1
  • Ikaros (zinc finger protein)
  • IKAROS family zinc finger 1 (Ikaros)
  • Ikaros family zinc finger protein 1
  • Ikaros
  • IKAROSLymphoid transcription factor LyF-1
  • IKZF1
  • LYF1
  • LyF-1
  • LYF1PRO0758
  • PRO0758
  • zinc finger protein, subfamily 1A, 1 (Ikaros)
  • ZNFN1A1
  • ZNFN1A1CLL-associated antigen KW-6

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-30927
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24495
Species: Hu, Pm
Applications: WB, ICC/IF
MAB73091
Species: Hu
Applications: WB, IHC
NBP2-38790
Species: Hu
Applications: IHC, IHC-P
NBP2-67429
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-38611
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-66228
Species: Hu
AF5165
Species: Hu, Mu
Applications: WB
NBP1-87709
Species: Hu
Applications: IHC, IHC-P
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-27163
Species: Hu, Mu, Bv, Ca, Eq, Pm
Applications: WB, Flow
NBP1-47492
Species: Hu, Bb
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB600-1071
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-31368
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-42210
Species: Hu
Applications: WB, Flow, IHC, IHC-P
AF800
Species: Hu, Mu
Applications: WB, Simple Western, IP
AF5129
Species: Hu
Applications: WB

Publications for Ikaros/IKZF1 Protein (NBP2-38242PEP) (0)

There are no publications for Ikaros/IKZF1 Protein (NBP2-38242PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Ikaros/IKZF1 Protein (NBP2-38242PEP) (0)

There are no reviews for Ikaros/IKZF1 Protein (NBP2-38242PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Ikaros/IKZF1 Protein (NBP2-38242PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Additional Ikaros/IKZF1 Products

Bioinformatics Tool for Ikaros/IKZF1 Protein (NBP2-38242PEP)

Discover related pathways, diseases and genes to Ikaros/IKZF1 Protein (NBP2-38242PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Ikaros/IKZF1 Protein (NBP2-38242PEP)

Discover more about diseases related to Ikaros/IKZF1 Protein (NBP2-38242PEP).
 

Pathways for Ikaros/IKZF1 Protein (NBP2-38242PEP)

View related products by pathway.

PTMs for Ikaros/IKZF1 Protein (NBP2-38242PEP)

Learn more about PTMs related to Ikaros/IKZF1 Protein (NBP2-38242PEP).
 

Research Areas for Ikaros/IKZF1 Protein (NBP2-38242PEP)

Find related products by research area.

Blogs on Ikaros/IKZF1

There are no specific blogs for Ikaros/IKZF1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

CD4 Antibody
NBP1-19371

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Ikaros/IKZF1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol IKZF1