IGSF8/CD316 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

IGSF8/CD316 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human IGSF8/CD316
  
  

  Source: E.coli

  Amino Acid Sequence: RLVAQLDTEGVGSLGPGYEGRHIAMEKVASRTYRLRLEAARPGDAGTYRCLAKAYVRGSGTRLREAASARSRPLPVHVRE

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: IGSF8
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10-100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-21398. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
• Theoretical MW: 26 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for IGSF8/CD316 Recombinant Protein Antigen

• CD316 antigen
• CD316
• CD81P3
• CD81P3LIR-D1
• EWI2
• EWI-2
• EWI2CD81 partner 3
• Glu-Trp-Ile EWI motif-containing protein 2
• IGSF8
• immunoglobulin superfamily, member 8
• KCT4
• KCT-4
• Keratinocytes-associated transmembrane protein 4
• PGRL
• PGRLimmunoglobulin superfamily member 8

Background

IGSF8 is a gene that codes for a protein that plays a role in diverse functions from oocytes fertilization to hepatitis C virus function, as well as working as a regulator of cell motility and neurite outgrowth and has three isomers with lengths of 613, 372, and 526 amino acids and weights of approximately 65, 40, and 56 kDa respectively. Current studies are being done on several diseases and disorders related to this gene including hepatitis C, prostate cancer, and glioblastoma. IGSF8 has also been shown to have interactions with CD81, CD9, CD82, ITGB1, and ADAM10.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: IGSF8