Recombinant Human IGSF2/CD101 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human IGSF2/CD101 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 653-759 of Human IGSF2 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:NRPPRASAISHPLRIAVTLPESKLKVNSRSQGQELSINSNTDIECSILSRSNGNLQLAIIWYFSPVSTNASWLKILEMDQTNVIKTGDEFHTPQRKQKFHTEKVSQD

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
CD101

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human IGSF2/CD101 Protein

  • CD101 antigen
  • CD101 molecule
  • CD101
  • Cell surface glycoprotein V7
  • EWI101
  • EWI-101
  • Glu-Trp-Ile EWI motif-containing protein 101
  • IGSF2
  • Leukocyte Surface Protein
  • member 2
  • V7

Background

IGSF2 - immunoglobulin superfamily, member 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
H00028299-P01
Species: Hu
AF1360
Species: Mu
Applications: WB, IHC
AF6567
Species: Hu, Mu
Applications: WB, IHC
AF3117
Species: Mu
Applications: WB, Flow, CyTOF-ready, ICC
NBP2-24867
Species: Hu, Mu
Applications: Flow, Func, In vitro, In vivo, CyTOF-ready, Flow-CS
AF4788
Species: Hu
Applications: WB, Flow, CyTOF-ready
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
MAB342
Species: Hu
Applications: WB, AgAct
MAB8400
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP1-42795
Species: Hu
Applications: WB, Flow, Func, IHC, IHC-Fr, IP, CyTOF-ready
NBP2-16155
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85161
Species: Hu
Applications: IHC, IHC-P
AF838
Species: Hu
Applications: WB, Flow, IHC, AgAct, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
H00009398-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for IGSF2/CD101 Partial Recombinant Protein (H00009398-Q01) (0)

There are no publications for IGSF2/CD101 Partial Recombinant Protein (H00009398-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IGSF2/CD101 Partial Recombinant Protein (H00009398-Q01) (0)

There are no reviews for IGSF2/CD101 Partial Recombinant Protein (H00009398-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for IGSF2/CD101 Partial Recombinant Protein (H00009398-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional IGSF2/CD101 Products

Bioinformatics Tool for IGSF2/CD101 Partial Recombinant Protein (H00009398-Q01)

Discover related pathways, diseases and genes to IGSF2/CD101 Partial Recombinant Protein (H00009398-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IGSF2/CD101 Partial Recombinant Protein (H00009398-Q01)

Discover more about diseases related to IGSF2/CD101 Partial Recombinant Protein (H00009398-Q01).
 

Pathways for IGSF2/CD101 Partial Recombinant Protein (H00009398-Q01)

View related products by pathway.

PTMs for IGSF2/CD101 Partial Recombinant Protein (H00009398-Q01)

Learn more about PTMs related to IGSF2/CD101 Partial Recombinant Protein (H00009398-Q01).

Blogs on IGSF2/CD101

There are no specific blogs for IGSF2/CD101, but you can read our latest blog posts.

Customers Who Bought This Also Bought

IL-2 [Unconjugated]
202-IL-010/CF

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human IGSF2/CD101 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CD101
Entrez