Home » IFT20 » IFT20 Antibodies » IFT20 Antibody

IFT20 Antibody

 Submit a Review

Images

 
(
Enlarge)
Western Blot: IFT20 Antibody [H00090410-B01P] - Analysis of IFT20 expression in transfected 293T cell line by IFT20 polyclonal antibody. Lane 1: IFT20 transfected lysate(16.28 KDa). Lane 2: Non-transfected lysate.
Western Blot: IFT20 Antibody [H00090410-B01P] - Analysis of IFT20 expression in transfected 293T cell line by IFT20 polyclonal antibody. Lane 1: IFT20 transfected lysate(16.28 KDa). Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

IFT20 Antibody Summary

Immunogen
IFT20 (NP_777547.1, 1 a.a. - 148 a.a.) full-length human protein. MAKDILGEAGLHFDELNKLRVLDPEVTQQTIELKEECKDFVDKIGQFQKIVGGLIELVDQLAKEAENEKMKSLAVSPRLECTGAISAHCKLCLSDSSDSPTSPSRVGGTTGHRCSELAQIYSKAERSSTAATSSPNSRKENAARKVSG
Specificity
IFT20 - intraflagellar transport 20 homolog (Chlamydomonas),
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
IFT20
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 1:500
Application Notes
Antibody reactive against transfected lysate in western blot. May also be used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for IFT20 Antibody

  • hIFT20
  • intraflagellar transport 20 homolog (Chlamydomonas)
  • intraflagellar transport protein 20 homolog
  • intraflagellar transport protein IFT20

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

IFT88 Antibody
NB100-2475
Flow Cytometry: IFT88 Antibody [NB100-2475] - Analysis of paraformaldehyde fixed HepG2 cells (blue line), permeabilized with 0.5% Triton. Primary incubation 1hr (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (1 ug/mL). IgG control: Unimmunized goat IgG (black line) followed by Alexa Fluor 488 secondary antibody.
Western Blot: IFT88 Antibody [NB100-2475] - Staining of A549 (A) cell lysate and Mouse Testes (B) lysate (35 ug protein in RIPA buffer). Antibody at 3 ug/mL. Detected by chemiluminescence.
Immunocytochemistry/Immunofluorescence: IFT88 Antibody [NB100-2475] - Analysis of paraformaldehyde fixed HepG2 cells, permeabilized with 0.15% Triton. Primary incubation 1hr (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (2 ug/mL), showing nuclear and cytoplasmic staining. The nuclear stain is DAPI (blue). Negative control: Unimmunized goat IgG (10ug/ml) followed by Alexa Fluor 488 secondary antibody (2 ug/mL).
(4 Publications)
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-Fr, PEP-ELISA, WB
Polycystin 2
Antibody
NBP3-06363
Western Blot: Polycystin 2 Antibody [NBP3-06363] - Anti-PKD2 rabbit polyclonal antibody at 1:500 dilutionLane A: HeLa Whole Cell LysateLane B: HEK293 Whole Cell LysateLane C: NIH3T3 Whole Cell LysateLysates/proteins at 30 ug per lane.SecondaryGoat Anti-Rabbit IgG (H+L) HRP at 110000 dilution.Developed using the ECL technique.Performed under reducing conditions.Predicted band size: 97 kDa
Immunoprecipitation: Polycystin 2 Antibody [NBP3-06363] - PKD2 was immunoprecipitated using:Lane A:0.5 mg HeLa Whole Cell Lysate4 uL anti-PKD2 rabbit polyclonal antibody and 60 ug of Immunomagnetic beads Protein AG. Primary antibody:Anti-PKD2 rabbit polyclonal antibody, at 1:100 dilution Secondary antibody:Goat Anti-Rabbit IgG (H+L) HRP at 110000 dilutionDeveloped using the ECL technique.Performed under reducing conditions.Predicted band size: 97 kDaObserved band size: 80 kDa
Immunocytochemistry/Immunofluorescence: Polycystin 2 Antibody [NBP3-06363] - Immunofluorescence staining of PKD2 in HeLa cells. Cells were fixed with 4% PFA, permeabilzed with 0.1% Triton X-100 in PBS,blocked with 10% serum, and incubated with rabbit anti-Human PKD2 polyclonal antibody (dilution ratio 1:200) at 4 degrees celsius overnight. Then cells were stained with the Alexa Fluor (TM) 488-conjugated Goat Anti-rabbit IgG secondary antibody (green) and counterstained with DAPI (blue).Positive staining was localized to Cytoplasm.
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
HIPPI Antibody
(OTI4F6)
NBP2-02313
Western Blot: HIPPI Antibody (4F6) [NBP2-02313] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY HIPPI (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-HIPPI.
Immunohistochemistry-Paraffin: HIPPI Antibody (4F6) [NBP2-02313] - Staining of paraffin-embedded Adenocarcinoma of colon tissue using anti-HIPPI mouse monoclonal antibody.
Immunohistochemistry-Paraffin: HIPPI Antibody (4F6) [NBP2-02313] - Staining of paraffin-embedded Adenocarcinoma of ovary tissue using anti-HIPPI mouse monoclonal antibody.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
IFT52 Antibody
NBP2-55756
Immunohistochemistry-Paraffin: IFT52 Antibody [NBP2-55756] - Staining of human fallopian tube shows high expression.
Immunohistochemistry-Paraffin: IFT52 Antibody [NBP2-55756] - Staining in human fallopian tube and liver tissues using anti-IFT52 antibody. Corresponding IFT52 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: IFT52 Antibody [NBP2-55756] - Staining of human liver shows low expression as expected.
Species: Hu
Applications: IHC, IHC-P
IFT172 Antibody
NBP1-90686
Immunohistochemistry-Paraffin: IFT172 Antibody [NBP1-90686] Staining of human lateral ventricle shows strong cytoplasmic positivity in astrocytes.
Species: Hu
Applications: IHC, IHC-P
Reg1A Antibody
[Unconjugated]
AF4937
Reg1A was detected in immersion fixed paraffin-embedded sections of human pancreas using Sheep Anti-Human Reg1A Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4937) at 3 µg/mL overnight at 4 °C. Before incubation with the primary antibody, tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained using the Anti-Sheep HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS019) and counterstained with hematoxylin (blue). Specific staining was localized to cytoplasm in exocrine cells. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Western blot shows lysates of human pancreas tissue. PVDF membrane was probed with 1 µg/mL of Sheep Anti-Human Reg1A Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4937) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). Specific bands were detected for Reg1A at approximately 20-22 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(1 Review)
Species: Hu
Applications: IHC, WB
p19 INK4d Antibody
(2E10)
H00001032-M08
Western Blot: p19 INK4d Antibody (2E10) [H00001032-M08] - Analysis of CDKN2D expression in transfected 293T cell line by CDKN2D monoclonal antibody (M08), clone 2E10. Lane 1: CDKN2D transfected lysatE (17.7 KDa). Lane 2: Non-transfected lysate.
Immunoprecipitation: p19 INK4d Antibody (2E10) [H00001032-M08] - Analysis of CDKN2D transfected lysate using anti-CDKN2D monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with CDKN2D rabbit polyclonal antibody.
Sandwich ELISA: p19 INK4d Antibody (2E10) [H00001032-M08] - Detection limit for recombinant GST tagged CDKN2D is 0.1 ng/ml as a capture antibody.
Species: Hu
Applications: ELISA, IP, S-ELISA, WB
INSIG-1 Antibody -
BSA Free
NB110-55244
Western Blot: INSIG-1 Antibody [NB110-55244] - Detection of Insig 1 in HepG2 lyaste using NB110-55244.
Immunocytochemistry/Immunofluorescence: INSIG-1 Antibody [NB110-55244] - INSIG-1 antibody was tested in HepG2 cells with Dylight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and Dylight 550 (red).
(1 Review)
(6 Publications)
Species: Hu, Rt
Applications: ICC/IF, WB
p19ARF/CDKN2A
Antibody - BSA Free
NB200-106
Immunohistochemistry: p19ARF/CDKN2A Antibody [NB200-106] - Adult mouse kidney (glomerulus). Image from verified customer review.
Western Blot: p19ARF/CDKN2A Antibody [NB200-106] - Analysis of p19ARF/CDKN2A in (A) NIH/3T3 and (B) MEF cells.
Immunocytochemistry/Immunofluorescence: p19ARF/CDKN2A Antibody [NB200-106] - Antibody was tested in MEF cells with DyLight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and DyLight 550 (red).
(1 Review)
(45 Publications)
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Recombinant Human
Blood group H inhibit ...
H00002523-P01
12.5% SDS-PAGE Stained with Coomassie Blue.
Species: Hu
Applications: ELISA, AP, PA, WB
HspB11 Antibody
NBP1-88332
Immunocytochemistry/Immunofluorescence: HspB11 Antibody [NBP1-88332] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & cytosol.
Western Blot: HspB11 Antibody [NBP1-88332] - Analysis in control (vector only transfected HEK293T lysate) and HSPB11 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: HspB11 Antibody [NBP1-88332] - Staining of human testis shows strong cytoplasmic positivity in cells of seminiferus ducts.
(2 Publications)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
EXOC5 Antibody
NBP2-99472
Immunohistochemistry-Paraffin: EXOC5 Antibody [NBP2-99472] - Immunochemical staining EXOC5 in human kidney with rabbit polyclonal antibody at 1:1000 dilution, formalin-fixed paraffin embedded sections.
Immunohistochemistry-Paraffin: EXOC5 Antibody [NBP2-99472] - Immunochemical staining EXOC5 in mouse kidney with rabbit polyclonal antibody at 1:1000 dilution, formalin-fixed paraffin embedded sections.
Immunohistochemistry-Paraffin: EXOC5 Antibody [NBP2-99472] - Immunochemical staining EXOC5 in rat kidney with rabbit polyclonal antibody at 1:1000 dilution, formalin-fixed paraffin embedded sections.
Species: Hu
Applications: IHC, IHC-P
HFE Antibody (1G12)
H00003077-M01
Western Blot: HFE Antibody (1G12) [H00003077-M01] - Analysis of HFE expression in transfected 293T cell line by HFE monoclonal antibody (M01), clone 1G12.Lane 1: HFE transfected lysate(40.1 KDa).Lane 2: Non-transfected lysate.
Immunocytochemistry/Immunofluorescence: HFE Antibody (1G12) [H00003077-M01] - Analysis of monoclonal antibody to HFE on HeLa cell. Antibody concentration 10 ug/ml.
Western Blot: HFE Antibody (1G12) [H00003077-M01] - HFE monoclonal antibody (M01), clone 1G12. Analysis of HFE expression in A-431.
(2 Reviews)
(1 Publication)
Species: Hu
Applications: ELISA, ICC/IF, WB
IL-23A/IL-23 P19
[Unconjugated]
1887-ML/CF
IL-23A/IL-23 P19 [Unconjugated]
(159 Publications)
Species: Mu
Applications: BA
Pericentrin
Antibody
NBP1-87772
Immunohistochemistry-Paraffin: Pericentrin Antibody [NBP1-87772] - Staining of human testis shows high expression.
Immunohistochemistry-Paraffin: Pericentrin Antibody [NBP1-87772] - Staining in human testis and liver tissues using anti-PCNT antibody. Corresponding PCNT RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Pericentrin Antibody [NBP1-87772] - Analysis in human testis and liver tissues. Corresponding Pericentrin RNA-seq data are presented for the same tissues.
(1 Review)
(2 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
Thyroid
receptor-interacting ...
NBP1-84534
Immunohistochemistry-Paraffin: Thyroid receptor-interacting protein 11 Antibody [NBP1-84534] - Staining of human pancreas shows strong cytoplasmic positivity with a granular pattern in exocrine glandular cells.
Immunocytochemistry/Immunofluorescence: Thyroid receptor-interacting protein 11 Antibody [NBP1-84534] - Immunofluorescent staining of human cell line U-251 MG shows localization to the Golgi apparatus.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Factor IX Antibody
NBP1-33581
Immunohistochemistry-Paraffin: Factor IX Antibody [NBP1-33581] - Mouse pancreas. Factor IX antibody [N3C3] diluted at 1:500. Antigen Retrieval: Citrate buffer, pH 6.0, 15 min.
Immunohistochemistry-Paraffin: Factor IX Antibody [NBP1-33581] - Mouse liver. Factor IX stained by Factor IX antibody [N3C3] diluted at 1:500.Antigen Retrieval: Citrate buffer, pH 6.0, 15 min.
Immunocytochemistry/Immunofluorescence: Factor IX Antibody [NBP1-33581] - HepG2 cells were fixed in 4% paraformaldehyde at RT for 15 min. Green: Factor IX protein stained by Factor IX antibody [N3C3] diluted at 1:500. Blue: Hoechst 33342 staining.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P
ErbB2/Her2
[Unconjugated]
1129-ER
1 μg/lane of Recombinant Human ErbB2 Fc Chimera was resolved with SDS-PAGE under reducing (R) and non-reducing (NR) conditions and visualized by silver staining, showing major bands at 125-130 kDa and  220-250 kDa, respectively.
(10 Reviews)
(48 Publications)
Species: Hu
Applications: BA
TMEM199 Antibody
NBP1-88467
Western Blot: TMEM199 Antibody [NBP1-88467] - Analysis in human cell line CACO-2.
Immunohistochemistry-Paraffin: TMEM199 Antibody [NBP1-88467] - Staining of human colon shows moderate cytoplasmic positivity in glandular cells.
Species: Hu
Applications: IHC, IHC-P, WB
IFT20 Antibody
H00090410-B01P
IFT20 Antibody
Species: Hu
Applications: WB

Publications for IFT20 Antibody (H00090410-B01P) (0)

There are no publications for IFT20 Antibody (H00090410-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IFT20 Antibody (H00090410-B01P) (0)

There are no reviews for IFT20 Antibody (H00090410-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for IFT20 Antibody (H00090410-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional IFT20 Products

Bioinformatics Tool for IFT20 Antibody (H00090410-B01P)

Discover related pathways, diseases and genes to IFT20 Antibody (H00090410-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IFT20 Antibody (H00090410-B01P)

Discover more about diseases related to IFT20 Antibody (H00090410-B01P).
 

Pathways for IFT20 Antibody (H00090410-B01P)

View related products by pathway.

Blogs on IFT20

There are no specific blogs for IFT20, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our IFT20 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol IFT20
Entrez
Uniprot