IFN-alpha C/IFN-alpha 10 Antibody - Azide and BSA Free Summary
| Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 24-100 of human IFN-alpha C/IFN-alpha 10 (NP_002162.1). CDLPQTHSLGNRRALILLGQMGRISPFSCLKDRHDFRIPQEEFDGNQFQKAQAISVLHEMIQQTFNLFSTEDSSAAW |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
IFNA10 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Western Blot 1:500 - 1:2000
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol |
| Preservative |
0.01% Thimerosal |
| Purity |
Affinity purified |
Alternate Names for IFN-alpha C/IFN-alpha 10 Antibody - Azide and BSA Free
Background
Produced by macrophages, IFN-alpha have antiviral activities. Interferon stimulates the production of twoenzymes: a protein kinase and an oligoadenylate synthetase
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Mu
Applications: BA
Species: Hu
Applications: ELISA, S-ELISA, WB
Species: Hu
Applications: BA
Species: Hu
Applications: IHC, IP, WB
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Hu
Applications: WB
Species: Mu
Applications: IP, WB
Species: Mu
Applications: WB
Species: Hu, Rt
Applications: WB
Species: Hu
Applications: IHC, IHC-P
⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov
Publications for IFN-alpha C/IFN-alpha 10 Antibody (NBP3-15494) (0)
There are no publications for IFN-alpha C/IFN-alpha 10 Antibody (NBP3-15494).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for IFN-alpha C/IFN-alpha 10 Antibody (NBP3-15494) (0)
There are no reviews for IFN-alpha C/IFN-alpha 10 Antibody (NBP3-15494).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for IFN-alpha C/IFN-alpha 10 Antibody (NBP3-15494) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional IFN-alpha C/IFN-alpha 10 Products
Research Areas for IFN-alpha C/IFN-alpha 10 Antibody (NBP3-15494)
Find related products by research area.
|
Blogs on IFN-alpha C/IFN-alpha 10