IER5 Antibody

Immunocytochemistry/Immunofluorescence: IER5 Antibody [NBP1-85935] - Staining of human cell line U-251 MG shows localization to nucleus & nucleoli. Antibody staining is shown in green.

Immunohistochemistry: IER5 Antibody [NBP1-85935] - Staining of mouse olfactory bulb shows weak labeling in the external plexiform layer.

Immunohistochemistry-Paraffin: IER5 Antibody [NBP1-85935] - Staining of human bone marrow shows moderate cytoplasmic positivity in hematopoietic cells.

Immunohistochemistry-Paraffin: IER5 Antibody [NBP1-85935] - Staining of human cerebral cortex shows moderate positivity in neuropil.

Immunohistochemistry: IER5 Antibody [NBP1-85935] - Representative images of IER5 protein staining. According to IHC immunostaining determination, patients dichotomized into high IER5 expression group (+2/+3) (Ba) and low IER5 expression group (0/+1) (Bb). Original magnification: 200 x, 400 x. Scale bars: 25.0 um. Abbreviations: IER5, immediate-early response5; IHC, immunohistochemistry. Each assay was performed at least three times, and the results are expressed as means +/- SD. *P < 0.05, **P < 0.01. Image collected and cropped by CiteAb from the following publication (//www.oncotarget.com/fulltext/16857), licensed under a CC-BY license.

Immunohistochemistry: IER5 Antibody [NBP1-85935] - Staining of mouse caudate putamen shows weak synaptic-like immunoreactivity.

Immunohistochemistry: IER5 Antibody [NBP1-85935] - Staining of mouse hippocampus shows synaptic-like positivity.

Western Blot: IER5 Antibody [NBP1-85935] - IER5 expression in each group. (A) IER5 protein expression in human cervical cancer were treated with radiotherapy (radiation dose range from 0 Gy to 30 Gy), were assessed using Western blotting (Ab). The results are analyzed compare to the untreated control (0 Gy group). (Aa) Western blotting analysis were used, showing the similar results as qRT-PCR analysis. GAPDH protein expression is shown as an internal control. Each assay was performed at least three times, and the results are expressed as means +/- SD. *P < 0.05, **P < 0.01. Image collected and cropped by CiteAb from the following publication (//www.oncotarget.com/article/16857/text/), licensed under a CC-BY license.

Product Discontinued

IER5 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: RRNLEQPPSGGEDDDAEEMETGNVANLISIFGSSFSGLLRKSPGGGREEEEGEESGPEAAEPGQICCDKPV
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: IER5
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:20-1:50
  • Western Blot Validated for Western Blot from CiteAb
• Application Notes: IHC reported in scientific literature (PMID: 28430589). For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for IER5 Antibody

• immediate early response 5
• immediate early response gene 5 protein
• MGC102760
• SBBI48

Background

IER5 encodes a protein that is similar to other immediate early response proteins. In the mouse, a similar gene may play an important role in mediating the cellular response to mitogenic signals. Studies in rats found the expression of a similar gene to be increased after waking and sleep deprivation. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for IER5 Antibody (NBP1-85935)(2)

Publications using NBP1-85935

• Zheng JJ, He Y, Liu Y et al. Novel role of PAF1 in attenuating radiosensitivity in cervical cancer by inhibiting IER5 transcription Radiat Oncol 2020-05-29 [PMID: 32471508] (IHC-P, Human)
• Liu Y, Tian M, Zhao H et al. IER5 as a promising predictive marker promotes irradiation-induced apoptosis in cervical cancer tissues from patients undergoing chemoradiotherapy. Oncotarget. 2017-05-30 [PMID: 28430589] (IF/IHC, Human)

Bioinformatics

• Gene Symbol: IER5