IER5 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: IER5 Antibody [NBP1-85935] - Staining of human cell line U-251 MG shows localization to nucleus & nucleoli. Antibody staining is shown in green.
Immunohistochemistry: IER5 Antibody [NBP1-85935] - Staining of mouse olfactory bulb shows weak labeling in the external plexiform layer.
Immunohistochemistry-Paraffin: IER5 Antibody [NBP1-85935] - Staining of human bone marrow shows moderate cytoplasmic positivity in hematopoietic cells.
Immunohistochemistry-Paraffin: IER5 Antibody [NBP1-85935] - Staining of human cerebral cortex shows moderate positivity in neuropil.
Immunohistochemistry: IER5 Antibody [NBP1-85935] - Staining of mouse caudate putamen shows weak synaptic-like immunoreactivity.
Immunohistochemistry: IER5 Antibody [NBP1-85935] - Staining of mouse hippocampus shows synaptic-like positivity.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

IER5 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: RRNLEQPPSGGEDDDAEEMETGNVANLISIFGSSFSGLLRKSPGGGREEEEGEESGPEAAEPGQICCDKPV
Specificity
Specificity of human, mouse IER5 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
IER5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
IHC reported in scientific literature (PMID: 28430589). For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
IER5 Protein (NBP1-85935PEP)
Publications
Read Publications using
NBP1-85935 in the following applications:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for IER5 Antibody

  • immediate early response 5
  • immediate early response gene 5 protein
  • MGC102760
  • SBBI48

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-32530
Species: Hu
Applications: WB, IHC, IHC-P
AF3297
Species: Hu
Applications: WB
AF5510
Species: Hu
Applications: WB
NBP2-56845
Species: Hu
Applications: ICC/IF
NB100-56370
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-67484
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-87275
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF4055
Species: Mu
Applications: WB, Simple Western, IHC
NBP2-46085
Species: Hu
Applications: WB, IHC
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-67861
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89544
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33757
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NB100-616
Species: Hu, Mu, Rt, Md, Pm
Applications: WB, ChIP, EM, Flow, ICC/IF, IP, In vitro, Flow-IC
NBP2-50037
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, KO
NB100-56530
Species: Hu
Applications: WB
NB100-104
Species: Hu, Mu, Rt, Ca, Ma
Applications: WB, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP
NBP2-19535
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP, ChIP
NB110-55244
Species: Hu, Rt
Applications: WB, ICC/IF

Publications for IER5 Antibody (NBP1-85935)(2)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 2 applications: IHC, IHC-P.


Filter By Application
IHC
(1)
IHC-P
(1)
All Applications
Filter By Species
Human
(2)
All Species

Reviews for IER5 Antibody (NBP1-85935) (0)

There are no reviews for IER5 Antibody (NBP1-85935). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for IER5 Antibody (NBP1-85935) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional IER5 Products

Bioinformatics Tool for IER5 Antibody (NBP1-85935)

Discover related pathways, diseases and genes to IER5 Antibody (NBP1-85935). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IER5 Antibody (NBP1-85935)

Discover more about diseases related to IER5 Antibody (NBP1-85935).
 

Pathways for IER5 Antibody (NBP1-85935)

View related products by pathway.

PTMs for IER5 Antibody (NBP1-85935)

Learn more about PTMs related to IER5 Antibody (NBP1-85935).

Blogs on IER5

There are no specific blogs for IER5, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our IER5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol IER5