IER2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: IER2 Antibody [NBP2-56845] - Staining of human cell line MCF7 shows localization to nucleoplasm. Antibody staining is shown in green.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

IER2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: MEVQKEAQRIMTLSVWKMYHSRMQRGGLRLHRSLQ
Specificity
Specificity of human IER2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
IER2
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for IER2 Antibody

  • ETR101MGC111472
  • immediate early response 2
  • immediate early response gene 2 protein
  • MGC15265
  • Protein ETR101

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB110-75039
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
AF2818
Species: Hu
Applications: WB, ICC
NBP2-67360
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-89544
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88262
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85935
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP2-67861
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP1-88915
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56530
Species: Hu
Applications: WB
AF5510
Species: Hu
Applications: WB
NB100-1519
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, PEP-ELISA, IHC-FrFl
NBP2-37568
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB100-1029
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-30646
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-68874
Species: Hu, Mu, Rt
Applications: WB, PEP-ELISA
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P

Publications for IER2 Antibody (NBP2-56845) (0)

There are no publications for IER2 Antibody (NBP2-56845).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IER2 Antibody (NBP2-56845) (0)

There are no reviews for IER2 Antibody (NBP2-56845). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for IER2 Antibody (NBP2-56845) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional IER2 Products

Bioinformatics Tool for IER2 Antibody (NBP2-56845)

Discover related pathways, diseases and genes to IER2 Antibody (NBP2-56845). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IER2 Antibody (NBP2-56845)

Discover more about diseases related to IER2 Antibody (NBP2-56845).
 

Pathways for IER2 Antibody (NBP2-56845)

View related products by pathway.

PTMs for IER2 Antibody (NBP2-56845)

Learn more about PTMs related to IER2 Antibody (NBP2-56845).

Blogs on IER2

There are no specific blogs for IER2, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our IER2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol IER2
Novus 100% Guarantee