ID4 Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit ID4 Antibody - BSA Free (NBP3-10934) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human ID4 (NP_001537). Peptide sequence CYSRLRRLVPTIPPNKKVSKVEILQHVIDYILDLQLALETHPALLRQPPP |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
ID4 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
|
| Theoretical MW |
16 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for ID4 Antibody - BSA Free
Background
Transcription factors containing a basic helix-loop-helix (bHLH) motif regulate expression of tissue-specific genes ina number of mammalian and insect systems. DNA-binding activity of the bHLH proteins is dependent on formation of homo-and/or heterodimers. Dominant-negative HLH proteins encoded by Id-related genes, such as ID4, also contain theHLH-dimerization domain but lack the DNA-binding basic domain. Consequently, Id proteins inhibit binding to DNA andtranscriptional transactivation by heterodimerization with bHLH proteins (Pagliuca et al., 1995 (PubMed7665172)).(supplied by OMIM)
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: ICC, Simple Western, WB
Species: Bv, Ch, Eq, Ha, Hu, Pm, Rt
Applications: ICC/IF, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Mu
Applications: IHC, WB
Species: Hu, Mu, Rt
Applications: BA
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ChIP, Dual ISH-IHC, ICC, IHC, WB
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, KD, KO, WB
Species: Hu
Applications: ICC, WB
Species: Hu
Applications: IHC, WB
Species: Bv
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, RIA, RI, WB
Species: Hu
Applications: ChIP-EXO-SEQ, ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, S-ELISA, Simple Western, WB
Species: Hu
Applications: WB
Publications for ID4 Antibody (NBP3-10934) (0)
There are no publications for ID4 Antibody (NBP3-10934).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for ID4 Antibody (NBP3-10934) (0)
There are no reviews for ID4 Antibody (NBP3-10934).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for ID4 Antibody (NBP3-10934) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional ID4 Products
Blogs on ID4