Recombinant Human ID3 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human ID3 Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 119 of Human ID3 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MKALSPVRGCYEAVCCLSERSLAIARGRGKGPAAEEPLSLLDDMNHCYSRLRELVPGVPRGTQLSQVEILQRVIDYILDLQVVLAEPAPGPPDGPHLPIQTAELAPELVISNDKRSFCH

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
ID3
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Publications
Read Publication using H00003399-P01.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ID3 Protein

  • BHLHB25
  • bHLHb251R21
  • Class B basic helix-loop-helix protein 25
  • DNA-binding protein inhibitor ID-3
  • HEIR1
  • HEIR-1
  • Helix-loop-helix protein HEIR-1
  • ID-like protein inhibitor HLH 1R21
  • Inhibitor of DNA binding 3
  • inhibitor of DNA binding 3, dominant negative helix-loop-helix protein

Background

Members of the ID family of helix-loop-helix (HLH) proteins lack a basic DNA-binding domain and inhibit transcription through formation of nonfunctional dimers that are incapable of binding to DNA.[supplied by OMIM] ID3( AAH03107, 1 a.a. - 120 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF4377
Species: Hu, Mu
Applications: WB, ICC
NBP2-27194
Species: Hu, Rt, Bv, Ch, Eq, Ha, Pm
Applications: WB, ICC/IF
MAB7650
Species: Mu
Applications: WB, IHC
H00003400-B01P
Species: Hu
Applications: WB, ICC/IF
AF6116
Species: Hu
Applications: WB, ICC
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
H00001958-M03
Species: Hu, Rb
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-13958
Species: Hu
Applications: IHC, IHC-P
H00006938-M01
Species: Hu
Applications: WB, ELISA, IHC-P, RNAi
NB100-56511
Species: Hu, Mu, Rt, Fe
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
NB100-56510
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P

Publications for ID3 Recombinant Protein (H00003399-P01)(1)


Reviews for ID3 Recombinant Protein (H00003399-P01) (0)

There are no reviews for ID3 Recombinant Protein (H00003399-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ID3 Recombinant Protein (H00003399-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ID3 Products

Bioinformatics Tool for ID3 Recombinant Protein (H00003399-P01)

Discover related pathways, diseases and genes to ID3 Recombinant Protein (H00003399-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ID3 Recombinant Protein (H00003399-P01)

Discover more about diseases related to ID3 Recombinant Protein (H00003399-P01).
 

Pathways for ID3 Recombinant Protein (H00003399-P01)

View related products by pathway.

PTMs for ID3 Recombinant Protein (H00003399-P01)

Learn more about PTMs related to ID3 Recombinant Protein (H00003399-P01).
 

Research Areas for ID3 Recombinant Protein (H00003399-P01)

Find related products by research area.

Blogs on ID3

There are no specific blogs for ID3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

BMP-2 [Unconjugated]
355-BM-010/CF

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ID3 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ID3