ID3 Antibody

Images

 
Western Blot: ID3 Antibody [H00003399-B01P] - Analysis of ID3 expression in transfected 293T cell line by ID3 polyclonal antibody. Lane 1: ID3 transfected lysate(13.09 KDa). Lane 2: Non-transfected lysate.
Immunocytochemistry/ Immunofluorescence: ID3 Antibody [H00003399-B01P] - Analysis of purified antibody to ID3 on HeLa cell. (antibody concentration 10 ug/ml)

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

ID3 Antibody Summary

Immunogen
ID3 (AAH03107.1, 1 a.a. - 119 a.a.) full-length human protein. MKALSPVRGCYEAVCCLSERSLAIARGRGKGPAAEEPLSLLDDMNHCYSRLRELVPGVPRGTQLSQVEILQRVIDYILDLQVVLAEPAPGPPDGPHLPIQTAELAPELVISNDKRSFCH
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
ID3
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • Immunocytochemistry/Immunofluorescence
Application Notes
It has been used for WB, Functional and IF.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein G purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ID3 Antibody

  • BHLHB25
  • bHLHb251R21
  • Class B basic helix-loop-helix protein 25
  • DNA-binding protein inhibitor ID-3
  • HEIR1
  • HEIR-1
  • Helix-loop-helix protein HEIR-1
  • ID-like protein inhibitor HLH 1R21
  • Inhibitor of DNA binding 3
  • inhibitor of DNA binding 3, dominant negative helix-loop-helix protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF4377
Species: Hu, Mu
Applications: WB, ICC
NBP2-27194
Species: Hu, Rt, Bv, Ch, Eq, Ha, Pm
Applications: WB, ICC/IF
MAB7650
Species: Mu
Applications: WB, IHC
H00003400-B01P
Species: Hu
Applications: WB, ICC/IF
AF6116
Species: Hu
Applications: WB, ICC
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
H00001958-M03
Species: Hu, Rb
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-13958
Species: Hu
Applications: IHC, IHC-P
H00006938-M01
Species: Hu
Applications: WB, ELISA, IHC-P, RNAi
NB100-56511
Species: Hu, Mu, Rt, Fe
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
NB100-56510
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P

Publications for ID3 Antibody (H00003399-B01P) (0)

There are no publications for ID3 Antibody (H00003399-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ID3 Antibody (H00003399-B01P) (0)

There are no reviews for ID3 Antibody (H00003399-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ID3 Antibody (H00003399-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ID3 Products

Bioinformatics Tool for ID3 Antibody (H00003399-B01P)

Discover related pathways, diseases and genes to ID3 Antibody (H00003399-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ID3 Antibody (H00003399-B01P)

Discover more about diseases related to ID3 Antibody (H00003399-B01P).
 

Pathways for ID3 Antibody (H00003399-B01P)

View related products by pathway.

PTMs for ID3 Antibody (H00003399-B01P)

Learn more about PTMs related to ID3 Antibody (H00003399-B01P).
 

Research Areas for ID3 Antibody (H00003399-B01P)

Find related products by research area.

Blogs on ID3

There are no specific blogs for ID3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ID3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ID3
Uniprot