Recombinant Human ICB1 GST (N-Term) Protein

Images

 
SDS-Page: Recombinant Human ICB1 Protein [H00009473-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, PAGE, AP

Order Details

Recombinant Human ICB1 GST (N-Term) Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-111 of Human C1orf38 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MEGQQVILHLPLSQKGPFWTWEPSAPRTLLQVLQDPALKDLVLTCPTLPWHSLILRPQYEIQAIMHIFSSLRIAATRSAAQTQGEDLARVHQGWLQYVQQDSCPQEGPQAR

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Full Length Recombinant Protein
Gene
THEMIS2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • SDS-Page
  • Western Blot
Theoretical MW
37.95 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ICB1 GST (N-Term) Protein

  • basement membrane-induced
  • chromosome 1 open reading frame 38
  • ICB1
  • ICB-1
  • Induced by contact to basement membrane 1 protein
  • Protein ICB-1
  • protein THEMIS2
  • THEMIS2
  • Thymocyte-expressed molecule involved in selection protein 2

Background

C1orf38( AAH31655, 1 a.a. - 112 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-305
Species: Hu, Pm, Mu, Rb
Applications: ChIP, DB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP2-67360
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
NBP2-80405
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
AF3206
Species: Hu, Mu, Rt
Applications: ICC, Simple Western, WB
MAB37861
Species: Hu
Applications: ICC, Simple Western, WB
NBP2-29661
Species: Hu, Mu, Rt
Applications: ELISA
AF5415
Species: Hu
Applications: ICC, IHC, Simple Western, WB
NB100-689
Species: Hu, Rt
Applications: IHC, IHC-Fr, IHC-P, Simple Western, WB
NBP2-37568
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
AF6240
Species: Hu
Applications: ELISA, IHC, WB
NB100-56722
Species: Ca, Hu, Mu, Rb, Rt
Applications: B/N, DB, ELISA, Flow-CS, Flow, Func, ICC/IF, IP, In vitro, WB
D6050
Species: Hu
Applications: ELISA
NB100-56566
Species: Bv, Hu, Ma, Mu, Po, Rt
Applications: B/N, ChIP, CyTOF-ready, DB, Dual ISH-IHC, ELISA(Cap), ELISA, Flow-CS, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, KD, KO, PAGE, WB
NBP2-24875
Species: Ca, Hu, Mu
Applications: BA, B/N, Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, WB
NBP1-68874
Species: Hu, Mu, Rt
Applications: PEP-ELISA, WB
H00009473-P01
Species: Hu
Applications: WB, ELISA, PA, PAGE, AP

Publications for ICB1 Recombinant Protein (H00009473-P01) (0)

There are no publications for ICB1 Recombinant Protein (H00009473-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ICB1 Recombinant Protein (H00009473-P01) (0)

There are no reviews for ICB1 Recombinant Protein (H00009473-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ICB1 Recombinant Protein (H00009473-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ICB1 Products

Bioinformatics Tool for ICB1 Recombinant Protein (H00009473-P01)

Discover related pathways, diseases and genes to ICB1 Recombinant Protein (H00009473-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for ICB1 Recombinant Protein (H00009473-P01)

View related products by pathway.

PTMs for ICB1 Recombinant Protein (H00009473-P01)

Learn more about PTMs related to ICB1 Recombinant Protein (H00009473-P01).

Blogs on ICB1

There are no specific blogs for ICB1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ICB1 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol THEMIS2