IAH1 Antibody

Images

 
Immunohistochemistry-Paraffin: IAH1 Antibody [NBP3-17263] - Staining of human adrenal gland shows strong cytoplasmic and nuclear positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

IAH1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: KQHIPLEEYAANLKSMVQYLKSVDIPENRVILITPTPLCETAWEEQCIIQGCKL
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
IAH1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, pH 7.2, 40% glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for IAH1 Antibody

  • EC 3.1
  • isoamyl acetate-hydrolyzing esterase 1 homolog (S. cerevisiae)
  • isoamyl acetate-hydrolyzing esterase 1 homolog
  • MGC102860
  • S

Background

IAH1, also referred to as Isoamyl acetate-hydrolyzing esterase 1 homolog, has 248 amino acids and is approximately 27kDa. IAH1 is a member of the GDSL lipolytic enzyme family, and likely functions as a lipase. Research surrounding IAH1 has shown a possible link to alcoholism. IAH1 has also been shown to interact with alcohol dehydrogenase 5, ATP5O, CABC1, COQ2, and FAAH.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

212-GD/CF
Species: Hu
Applications: Bind, BA
NBP2-38747
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
NB100-81798
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-93638
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
NBP2-16134
Species: Hu
Applications: IHC, IHC-P, IP, WB
NB300-956
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
NBP1-31356
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-33471
Species: Hu
Applications: IHC, IHC-P
H00008847-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP3-05298
Species: Rt
Applications: Flow, Func, IHC-Fr, IP, WB
NBP1-49045
Species: Mu, Rt
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, InhibTFunc
NBP2-00810
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
H00010301-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP1-84307
Species: Hu
Applications: ICC/IF, WB

Publications for IAH1 Antibody (NBP3-17263) (0)

There are no publications for IAH1 Antibody (NBP3-17263).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IAH1 Antibody (NBP3-17263) (0)

There are no reviews for IAH1 Antibody (NBP3-17263). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for IAH1 Antibody (NBP3-17263) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional IAH1 Products

Bioinformatics Tool for IAH1 Antibody (NBP3-17263)

Discover related pathways, diseases and genes to IAH1 Antibody (NBP3-17263). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for IAH1 Antibody (NBP3-17263)

View related products by pathway.

Research Areas for IAH1 Antibody (NBP3-17263)

Find related products by research area.

Blogs on IAH1

There are no specific blogs for IAH1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our IAH1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol IAH1