We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Hydrogen Potassium ATPase Beta Recombinant Protein Antigen

Images

 
There are currently no images for Hydrogen Potassium ATPase Beta Protein (NBP2-38674PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Hydrogen Potassium ATPase Beta Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ATP4B.

Source: E. coli

Amino Acid Sequence: LQNCSGLADPNFGFEEGKPCFIIKMNRIVKFLPSNGSAPRVDCAFLDQPRELGQPLQVKYYPPNGTFSLHYFP

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ATP4B
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-38674.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Hydrogen Potassium ATPase Beta Recombinant Protein Antigen

  • ATP4B
  • ATP6B
  • ATPase, H+/K+ exchanging, beta polypeptide
  • ATPase, H+/K+ transporting, beta polypeptide
  • Gastric H(+)/K(+) ATPase subunit beta
  • gastric H+/K+ ATPase beta subunit
  • gastric hydrogen-potassium ATPase, beta
  • Hydrogen Potassium ATPase Beta
  • potassium-transporting ATPase beta chain
  • potassium-transporting ATPase subunit beta
  • Proton pump beta chain

Background

The hydrogen/potassium ATPase, or gastric proton pump, belongs to a family of P-type cation-transporting ATPases. This family of ATPases shares a number of functional and structural similarities including the common feature of consisting of an alpha and beta subunit. Like the ubiquitous sodium/potassium ATPase, the hydrogen/potassium ATPase consists of a large transmembrane catalytic subunit, termed the alpha-subunit which contains sites for ATP binding and phosphorylation, and an associated smaller glycoprotein, termed the beta-subunit which may play a role in maintaining the structural and functional integrity of the complex.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-88889
Species: Hu
Applications: IHC,  IHC-P
DCX900
Species: Hu
Applications: ELISA
NBP1-92180
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, KD
AF2247
Species: Hu
Applications: IHC, WB
AF808
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), ICC, IHC, Neut, WB
NBP2-32887
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-80670
Species: Hu
Applications: IHC,  IHC-P
NB300-731
Species: Gp, Hu, Mu, Rb, Rt, Sh, Ye
Applications: B/N, ChIP, Flow, GS, ICC/IF, IHC,  IHC-P, IP, WB
AF009
Species: Hu
Applications: IHC, WB
NBP1-78249
Species: Hu, Pm, Mu, Po, Pm, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, WB
NBP2-16679
Species: Dr, Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
AF960
Species: Hu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
NBP2-66888
Species: Hu, Mu, Rt
Applications:  IHC-P, IP, Simple Western, WB
NBP1-90312
Species: Hu
Applications: IHC,  IHC-P
AF1513
Species: Mu
Applications: CyTOF-ready, Flow, IHC, IP, Simple Western, WB
288-TPN/CF
Species: Hu
Applications: BA
AF2097
Species: Hu
Applications: ChIP, ICC, WB
NBP3-27690
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IP, WB

Publications for Hydrogen Potassium ATPase Beta Protein (NBP2-38674PEP) (0)

There are no publications for Hydrogen Potassium ATPase Beta Protein (NBP2-38674PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Hydrogen Potassium ATPase Beta Protein (NBP2-38674PEP) (0)

There are no reviews for Hydrogen Potassium ATPase Beta Protein (NBP2-38674PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Hydrogen Potassium ATPase Beta Protein (NBP2-38674PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Hydrogen Potassium ATPase Beta Products

Research Areas for Hydrogen Potassium ATPase Beta Protein (NBP2-38674PEP)

Find related products by research area.

Blogs on Hydrogen Potassium ATPase Beta

There are no specific blogs for Hydrogen Potassium ATPase Beta, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Hydrogen Potassium ATPase Beta Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol ATP4B