Recombinant Human Hyaluronan Synthase 3/HAS3 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Hyaluronan Synthase 3/HAS3 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-281 of Human HAS3 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MPVQLTTALRVVGTSLFALAVLGGILAAYVTGYQFIHTEKHYLSFGLYGAILGLHLLIQSLFAFLEHRRMRRAGQALKLPSPRRGSVALCIAAYQEDPDYLRKCLRSAQRISFPDLKVVMVVDGNRQEDAYMLDIFHEVLGGTEQAGFFVWRSNFHEAGEGETEASLQEGMDRVRDVVRASTFSCIMQKWGGKREVMYTAFKALGDSVDYIQVCDSDTVLDPACTIEMLRVLEEDPQVGGVGGDVQPPGKGMAVEDDQVQAAQVRATEAWSVHQRHVSREQ

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
HAS3
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Hyaluronan Synthase 3/HAS3 Protein

  • EC 2.4.1.212
  • HA synthase 3
  • HAS3
  • Hyaluronan Synthase 3
  • Hyaluronate synthase 3
  • Hyaluronic acid synthase 3

Background

HAS3( AAH21853, 1 a.a. - 282 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-51635
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-37446
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC
NBP1-47386
Species: Hu, Mu, Rb(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-81637
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-81283
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-83409
Species: Hu
Applications: IHC, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-76538
Species: Hu, Mu, Rt, Po
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-30943
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF1034
Species: Mu, Rt
Applications: WB, Simple Western, IHC
H00003038-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for Hyaluronan Synthase 3/HAS3 Recombinant Protein (H00003038-P01) (0)

There are no publications for Hyaluronan Synthase 3/HAS3 Recombinant Protein (H00003038-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Hyaluronan Synthase 3/HAS3 Recombinant Protein (H00003038-P01) (0)

There are no reviews for Hyaluronan Synthase 3/HAS3 Recombinant Protein (H00003038-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Hyaluronan Synthase 3/HAS3 Recombinant Protein (H00003038-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Hyaluronan Synthase 3/HAS3 Products

Bioinformatics Tool for Hyaluronan Synthase 3/HAS3 Recombinant Protein (H00003038-P01)

Discover related pathways, diseases and genes to Hyaluronan Synthase 3/HAS3 Recombinant Protein (H00003038-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Hyaluronan Synthase 3/HAS3 Recombinant Protein (H00003038-P01)

Discover more about diseases related to Hyaluronan Synthase 3/HAS3 Recombinant Protein (H00003038-P01).
 

Pathways for Hyaluronan Synthase 3/HAS3 Recombinant Protein (H00003038-P01)

View related products by pathway.

PTMs for Hyaluronan Synthase 3/HAS3 Recombinant Protein (H00003038-P01)

Learn more about PTMs related to Hyaluronan Synthase 3/HAS3 Recombinant Protein (H00003038-P01).

Blogs on Hyaluronan Synthase 3/HAS3

There are no specific blogs for Hyaluronan Synthase 3/HAS3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

IL-4 [Unconjugated]
204-IL-010/CF

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Hyaluronan Synthase 3/HAS3 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol HAS3
Entrez