Recombinant Human Hyaluronan Synthase 3/HAS3 GST (N-Term) Protein

Images

 
SDS-Page: Recombinant Human Hyaluronan Synthase 3/HAS3 Protein [H00003038-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, PAGE, AP

Order Details

Recombinant Human Hyaluronan Synthase 3/HAS3 GST (N-Term) Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-281 of Human HAS3 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MPVQLTTALRVVGTSLFALAVLGGILAAYVTGYQFIHTEKHYLSFGLYGAILGLHLLIQSLFAFLEHRRMRRAGQALKLPSPRRGSVALCIAAYQEDPDYLRKCLRSAQRISFPDLKVVMVVDGNRQEDAYMLDIFHEVLGGTEQAGFFVWRSNFHEAGEGETEASLQEGMDRVRDVVRASTFSCIMQKWGGKREVMYTAFKALGDSVDYIQVCDSDTVLDPACTIEMLRVLEEDPQVGGVGGDVQPPGKGMAVEDDQVQAAQVRATEAWSVHQRHVSREQ

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Full Length Recombinant Protein
Gene
HAS3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • SDS-Page
  • Western Blot
Theoretical MW
56.65 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Hyaluronan Synthase 3/HAS3 GST (N-Term) Protein

  • EC 2.4.1.212
  • HA synthase 3
  • HAS3
  • Hyaluronan Synthase 3
  • Hyaluronate synthase 3
  • Hyaluronic acid synthase 3

Background

HAS3( AAH21853, 1 a.a. - 282 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-51635
Species: Hu
Applications: ELISA, ICC/IF, WB
NBP2-37446
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP1-47386
Species: Hu, Mu, Rb(-)
Applications: ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, WB
NBP1-81637
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-81283
Species: Hu
Applications: IHC, IHC-P, WB
210-TA
Species: Hu
Applications: BA
NBP1-00201
Species: Hu
Applications: Flow, IF, IHC, PEP-ELISA
6507-IL/CF
Species: Hu
Applications: BA
DY413
Species: Mu
Applications: ELISA
236-EG
Species: Hu
Applications: BA
NBP2-22203
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP2-67360
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, KO, WB
233-FB/CF
Species: Hu
Applications: BA
NBP1-76538
Species: Hu, Mu, Po, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
AF3194
Species: Hu
Applications: ICC, Simple Western, WB
AF1034
Species: Mu, Rt
Applications: IHC, Simple Western, WB
285-IF
Species: Hu
Applications: BA
H00003038-P01
Species: Hu
Applications: WB, ELISA, PA, PAGE, AP

Publications for Hyaluronan Synthase 3/HAS3 Recombinant Protein (H00003038-P01) (0)

There are no publications for Hyaluronan Synthase 3/HAS3 Recombinant Protein (H00003038-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Hyaluronan Synthase 3/HAS3 Recombinant Protein (H00003038-P01) (0)

There are no reviews for Hyaluronan Synthase 3/HAS3 Recombinant Protein (H00003038-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Hyaluronan Synthase 3/HAS3 Recombinant Protein (H00003038-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Hyaluronan Synthase 3/HAS3 Products

Bioinformatics Tool for Hyaluronan Synthase 3/HAS3 Recombinant Protein (H00003038-P01)

Discover related pathways, diseases and genes to Hyaluronan Synthase 3/HAS3 Recombinant Protein (H00003038-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Hyaluronan Synthase 3/HAS3 Recombinant Protein (H00003038-P01)

Discover more about diseases related to Hyaluronan Synthase 3/HAS3 Recombinant Protein (H00003038-P01).
 

Pathways for Hyaluronan Synthase 3/HAS3 Recombinant Protein (H00003038-P01)

View related products by pathway.

PTMs for Hyaluronan Synthase 3/HAS3 Recombinant Protein (H00003038-P01)

Learn more about PTMs related to Hyaluronan Synthase 3/HAS3 Recombinant Protein (H00003038-P01).

Blogs on Hyaluronan Synthase 3/HAS3

There are no specific blogs for Hyaluronan Synthase 3/HAS3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Hyaluronan Synthase 3/HAS3 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol HAS3