HSP20/HSPB6 Recombinant Protein Antigen

Images

 
There are currently no images for HSP20/HSPB6 Protein (NBP2-32027PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

HSP20/HSPB6 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human HSPB6.

Source: E.coli

Amino Acid Sequence: DQRFGEGLLEAELAALCPTTLAPYYLRAPSVALPVAQVPTDPGHFSVLLDVK

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
HSPB6
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-32027.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for HSP20/HSPB6 Recombinant Protein Antigen

  • FLJ32389
  • Heat shock 20 kDa-like protein p20
  • heat shock protein beta-6
  • heat shock protein, alpha-crystallin-related, B6
  • HSP20
  • HSPB6

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-32972
Species: Hu, Mu, Rt, Ch, Pm, Pm, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-84945
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NB100-2519
Species: Hu, Mu
Applications: WB, ICC/IF
NBP2-67817
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF2584
Species: Mu
Applications: WB, Simple Western
NBP2-99273
Species: Mu
Applications: WB, IHC, IHC-P, IP
NBP1-77397
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IB, ICC/IF, IHC, IHC-P, KD
NBP2-07644
Species: Hu
NBP2-15195
Species: Hu, Mu, Po, Bv
Applications: Flow, ICC/IF, IHC, IHC-P
NBP1-77685
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-27202
Species: Hu, Mu, Rt, Po, Ca, Ch, ChHa, Fe, Ma-Op, Pm
Applications: WB, Simple Western, ICC/IF
NBP2-13469
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB4470
Species: All-Multi
Applications: WB, IHC, ICC
NBP2-13075
Species: Hu, Mu, Rt, Ba, Pm
Applications: WB, DB, ELISA, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NB100-56708
Species: Hu, Mu, Rt, Po, Ch, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, HEStain, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, IHC-FrFl, KD, KO
NBP2-32027PEP
Species: Hu
Applications: AC

Publications for HSP20/HSPB6 Protein (NBP2-32027PEP) (0)

There are no publications for HSP20/HSPB6 Protein (NBP2-32027PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HSP20/HSPB6 Protein (NBP2-32027PEP) (0)

There are no reviews for HSP20/HSPB6 Protein (NBP2-32027PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for HSP20/HSPB6 Protein (NBP2-32027PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Additional HSP20/HSPB6 Products

Bioinformatics Tool for HSP20/HSPB6 Protein (NBP2-32027PEP)

Discover related pathways, diseases and genes to HSP20/HSPB6 Protein (NBP2-32027PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HSP20/HSPB6 Protein (NBP2-32027PEP)

Discover more about diseases related to HSP20/HSPB6 Protein (NBP2-32027PEP).
 

Pathways for HSP20/HSPB6 Protein (NBP2-32027PEP)

View related products by pathway.

PTMs for HSP20/HSPB6 Protein (NBP2-32027PEP)

Learn more about PTMs related to HSP20/HSPB6 Protein (NBP2-32027PEP).

Blogs on HSP20/HSPB6

There are no specific blogs for HSP20/HSPB6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our HSP20/HSPB6 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol HSPB6