HSF2 Antibody (1F11-A3)

Images

 
Immunocytochemistry/ Immunofluorescence: HSF2 Antibody (1F11-A3) [H00003298-M01] - Analysis of monoclonal antibody to HSF2 on HeLa cell. Antibody concentration 10 ug/ml.
Sandwich ELISA: HSF2 Antibody (1F11-A3) [H00003298-M01] - Detection limit for recombinant GST tagged HSF2 is approximately 0.3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
1F11-A3
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

HSF2 Antibody (1F11-A3) Summary

Immunogen
HSF2 (AAH05329, 1 a.a. - 230 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MKQSSNVPAFLSKLWTLVEETHTNEFITWSQNGQSFLVLDEQRFAKEILPKYFKHNNMASFVRQLNMYGFRKVVHIDSGIVKQERDGPVEFQHPYFKQGQDDLLENIKRKVSSSKPEENKIRQEDLTKIISSAQKVQIKQETIESRLSELKSENESLWKEVSELRAKHAQQQQVIRKIVQFIVTLVQNNQLVSLKRKRPLLLNTNGAQKKNLFQHIVKEPTDNHHHKVIF
Localization
Cytoplasmic during normal growth and moves to the nucleus upon activation.
Specificity
HSF2 - heat shock transcription factor 2
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
HSF2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for HSF2 Antibody (1F11-A3)

  • heat shock factor 2
  • heat shock factor protein 2
  • heat shock transcription factor 2MGC75048
  • HSF 2
  • HSF2
  • HSTF 2
  • HSTF2
  • MGC117376
  • MGC156196

Background

HSF2, as well as the related gene HSF1, encodes a protein that binds specifically to the heat-shock element and has homology to HSFs of other species. Heat shock transcription factors activate heat-shock response genes under conditions of heat or other stresses. Although the names HSF1 and HSF2 were chosen for historical reasons, these peptides should be referred to as heat-shock transcription factors.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-97475
Species: Hu, Mu, Rt, Ge, Pm, Rb
Applications: WB, ELISA, EIA, GS, IP
NBP1-81696
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB5695
Species: Hu, Mu
Applications: WB
NBP1-02459
Species: Hu, Mu, Rt, Ch, Dr, Pm
Applications: WB, ELISA, IHC, IHC-P
H00008630-P01
Species: Hu
NBP2-32972
Species: Hu, Mu, Rt, Ch, Pm, Sh
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB120-2928
Species: Hu, Mu, Rt, Pm, Rb, Sh
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
AF1227
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NB600-233
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, PLA
NB100-56508
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P, CyTOF-ready, Flow-CS
NB120-2788
Species: Hu, Mu, Rt, Bv, Fe, Fi, Ha, Pm
Applications: WB, B/N, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-01223
Species: Hu
Applications: WB, Flow, IHC, IHC-P
MAB6799
Species: Hu
Applications: WB, IHC
H00003298-M01
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for HSF2 Antibody (H00003298-M01) (0)

There are no publications for HSF2 Antibody (H00003298-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HSF2 Antibody (H00003298-M01) (0)

There are no reviews for HSF2 Antibody (H00003298-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for HSF2 Antibody (H00003298-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HSF2 Products

Bioinformatics Tool for HSF2 Antibody (H00003298-M01)

Discover related pathways, diseases and genes to HSF2 Antibody (H00003298-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HSF2 Antibody (H00003298-M01)

Discover more about diseases related to HSF2 Antibody (H00003298-M01).
 

Pathways for HSF2 Antibody (H00003298-M01)

View related products by pathway.

PTMs for HSF2 Antibody (H00003298-M01)

Learn more about PTMs related to HSF2 Antibody (H00003298-M01).

Blogs on HSF2

There are no specific blogs for HSF2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HSF2 Antibody (1F11-A3) and receive a gift card or discount.

Bioinformatics

Gene Symbol HSF2
Entrez
OMIM
Uniprot