HS3ST5 Antibody

Images

 
Western Blot: HS3ST5 Antibody [NBP1-69629] - This Anti-HS3ST5 antibody was used in Western Blot of MCF7 tissue lysate at a concentration of 0.5ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

HS3ST5 Antibody Summary

Immunogen
Synthetic peptides corresponding to HS3ST5(heparan sulfate (glucosamine) 3-O-sulfotransferase 5) The peptide sequence was selected from the C terminal of HS3ST5. Peptide sequence SQYNLYFNATRGFYCLRFNIIFNKCLAGSKGRIHPEVDPSVITKLRKFFH.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HS3ST5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against HS3ST5 and was validated on Western blot.
Theoretical MW
40 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for HS3ST5 Antibody

  • 3-OST-5EC 2.8.2.23
  • 3OST5NBLA04021
  • EC 2.8.2
  • h3-OST-5
  • heparan sulfate (glucosamine) 3-O-sulfotransferase 5
  • heparan sulfate 3-OST-5
  • Heparan sulfate 3-O-sulfotransferase 5
  • Heparan sulfate D-glucosaminyl 3-O-sulfotransferase 5
  • heparan sulfate glucosamine 3-O-sulfotransferase 5
  • HS3OST5

Background

HS3ST5 is the rate limiting enzyme for synthesis of HSact. It performs the crucial step modification in the biosynthesis of anticoagulant heparan sulfate (HSact) that is to complete the structure of the antithrombin pentasaccharide binding site. HS3ST5 also generates GlcUA-GlcNS or IdoUA-GlcNS and IdoUA2S-GlcNH2. The substrate-specific O-sulfation generates an enzyme-modified heparan sulfate which acts as a binding receptor to Herpes simplex virus-1 (HSV-1) and permits its entry.HS3ST5 belongs to a group of heparan sulfate 3-O-sulfotransferases (EC 2.8.2.23) that transfer sulfate from 3-prime-phosphoadenosine 5-prime phosphosulfate (PAPS) to heparan sulfate and heparin (Mochizuki et al., 2003 [PubMed 12740361]).[supplied by OMIM]. Sequence Note: The RefSeq transcript and protein were derived from genomic sequence to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on alignments. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-139 AL355498.10 32491-32629 c 140-2744 AL355498.10 25338-27942 c

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-23603
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF5968
Species: Hu
Applications: WB, IP
NBP1-33320
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-77242
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IF
NBP2-49661
Species: Hu
Applications: WB, IHC
NB100-2421
Species: Hu
Applications: WB, Flow, IHC, IHC-P, PEP-ELISA
H00003845-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
AF1267
Species: Hu
Applications: WB, IP, Neut
PPS010
Species: Hu, Mu, Rt, Bv, Ch, Xp, Ze
Applications: WB
NBP1-87109
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24649
Species: Hu, Po, Bv, Eq, Fe, Pm
Applications: WB
AF1638
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
NBP1-76690
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-97773
Species: Hu
Applications: WB, PEP-ELISA
NBP2-01198
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-69629
Species: Hu
Applications: WB

Publications for HS3ST5 Antibody (NBP1-69629) (0)

There are no publications for HS3ST5 Antibody (NBP1-69629).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HS3ST5 Antibody (NBP1-69629) (0)

There are no reviews for HS3ST5 Antibody (NBP1-69629). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HS3ST5 Antibody (NBP1-69629) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HS3ST5 Products

Bioinformatics Tool for HS3ST5 Antibody (NBP1-69629)

Discover related pathways, diseases and genes to HS3ST5 Antibody (NBP1-69629). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HS3ST5 Antibody (NBP1-69629)

Discover more about diseases related to HS3ST5 Antibody (NBP1-69629).

Blogs on HS3ST5

There are no specific blogs for HS3ST5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HS3ST5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HS3ST5
Uniprot