HS3ST2 Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit HS3ST2 Antibody - BSA Free (NBP2-87601) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human HS3ST2. Peptide sequence: SAPAAAVPAPRLSGSNHSGSPKLGTKRLPQALIVGVKKGGTRAVLEFIRV The peptide sequence for this immunogen was taken from within the described region. |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
HS3ST2 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for HS3ST2 Antibody - BSA Free
Background
HS3ST2 codes for a protein with a length of 367 amino acids and a weight of approximately 41.5 kDa, that is a sulfotransferase that utilizes PAPS and works to transfer a sulfo group to a glucosamine on heparan sulfate, without causing the heparan sulfate to being its anticoagulant form and is highly expressed in the brain with a lesser expression in the heart, lung and skeletal muscle. Current studies are being done on several diseases and disorders related to this gene including herpes simplex, chondrosarcoma, pancreatic cancer, colorectal cancer, pancreatitis, schizophrenia, and neuronitis. HS3ST2 has also been shown to have interactions with GLCE, GPC1, GPC2, GPC4, and GPC5 in pathways such as the heparan sulfate biosynthesis, metapathway biotransformation, Maroteaux-Lamy syndrome, metabolism, and Hunter syndrome pathways.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: IP, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow, Simple Western, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Mu
Applications: IP, WB
Species: Hu, Mu(-)
Applications: CyTOF-ready, Flow-IC, Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu
Applications: IHC, IP
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, ICC, IHC, Simple Western, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: InhibAct
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, IHC, IHC-P, KD, S-ELISA, WB
Species: Hu
Applications: WB
Publications for HS3ST2 Antibody (NBP2-87601) (0)
There are no publications for HS3ST2 Antibody (NBP2-87601).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for HS3ST2 Antibody (NBP2-87601) (0)
There are no reviews for HS3ST2 Antibody (NBP2-87601).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for HS3ST2 Antibody (NBP2-87601) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional HS3ST2 Products
Blogs on HS3ST2