HRAS Antibody

Western Blot: vH RAS Antibody [H00003265-B01P] - Analysis of HRAS expression in transfected 293T cell line by HRAS polyclonal antibody. Lane 1: HRAS transfected lysate(20.79 KDa). Lane 2: Non-transfected lysate.

Proximity Ligation Assay: vH RAS Antibody [H00003265-B01P] - Analysis of protein-protein interactions between PIK3R1 and HRAS. HeLa cells were stained with anti-PIK3R1 rabbit purified polyclonal 1:1200 and anti-HRAS mouse purified polyclonal antibody 1:50. Each red dot represents the detection of protein-protein in

Product Discontinued

HRAS Antibody Summary

• Description: Quality control test: Antibody reactive against mammalian transfected lysate.
• Immunogen: HRAS (NP_005334, 1 a.a. - 189 a.a.) full-length human protein. MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGPGCMSCKCVLS
• Specificity: HRAS - v-Ha-ras Harvey rat sarcoma viral oncogene homolog,
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: HRAS
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Proximity Ligation Assay
  • Western Blot
• Application Notes: Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for HRAS Antibody

• C-BAS/HAS;C-HA-RAS1;C-H-RAS;CTLO;GTPase HRas;HAMSV;HRAS1;H-RASIDX;p21ras;RASH1

Background

This gene belongs to the Ras oncogene family, whose members are related to the transforming genes of mammalian sarcoma retroviruses. The products encoded by these genes function in signal transduction pathways. These proteins can bind GTP and GDP, and they have intrinsic GTPase activity. This protein undergoes a continuous cycle of de- and re-palmitoylation, which regulates its rapid exchange between the plasma membrane and the Golgi apparatus. Mutations in this gene cause Costello syndrome, a disease characterized by increased growth at the prenatal stage, growth deficiency at the postnatal stage, predisposition to tumor formation, mental retardation, skin and musculoskeletal abnormalities, distinctive facial appearance and cardiovascular abnormalities. Defects in this gene are implicated in a variety of cancers, including bladder cancer, follicular thyroid cancer, and oral squamous cell carcinoma. Multiple transcript variants, which encode different isoforms, have been identified for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: HRAS
• Entrez:
  • 3265(Human)
• Uniprot:
  • NP_005334(Human)