HPSC152 Antibody

Images

 
Independent Antibodies: Western Blot: HPSC152 Antibody [NBP1-92009] - Analysis using Anti-TRMT112 antibody NBP1-92009 (A) shows similar pattern to independent antibody NBP1-92008 (B).
Immunohistochemistry-Paraffin: HPSC152 Antibody [NBP1-92009] - Staining of human adrenal gland shows nuclear and cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P, IP
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
 

Independent Antibodies

       

Order Details

HPSC152 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LIQVPKGPVEGYEENEEFLRTMHHLLLEVEVIEGTLQCPESGRMFPISRGIPNMLLSEEETES
Specificity
Specificity of human HPSC152 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TRMT112
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Immunoprecipitation
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
HPSC152 Protein (NBP1-92009PEP)
Publications
Read Publication using NBP1-92009.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 26214185)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for HPSC152 Antibody

  • HSPC152
  • HSPC170
  • TRM112
  • TRM112-like protein
  • TRMT11-2
  • tRNA methyltransferase 11-2 homolog (S. cerevisiae)
  • tRNA methyltransferase 112 homolog

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-86906
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-50465
Species: Hu
Applications: Flow, IHC, IHC-P, CyTOF-ready, Flow-CS
NBP1-31113
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84010
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF5059
Species: Hu
Applications: WB, IHC
H00221527-B01P
Species: Hu
Applications: WB, ICC/IF
NBP2-13957
Species: Hu
Applications: WB, IHC, IHC-P
AF6144
Species: Hu
Applications: WB, Simple Western
NBP3-03312
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF3798
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, KO
NBP2-71419
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
MAB943
Species: Hu, Mu
Applications: WB, Flow, CyTOF-ready
NBP1-81238
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-92009
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP

Publications for HPSC152 Antibody (NBP1-92009)(1)

We have publications tested in 3 applications: ICC/IF, IP, WB.


Filter By Application
ICC/IF
(1)
IP
(1)
WB
(1)
All Applications
Filter By Species
All Species

Reviews for HPSC152 Antibody (NBP1-92009) (0)

There are no reviews for HPSC152 Antibody (NBP1-92009). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for HPSC152 Antibody (NBP1-92009) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional HPSC152 Products

Bioinformatics Tool for HPSC152 Antibody (NBP1-92009)

Discover related pathways, diseases and genes to HPSC152 Antibody (NBP1-92009). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HPSC152 Antibody (NBP1-92009)

Discover more about diseases related to HPSC152 Antibody (NBP1-92009).
 

Pathways for HPSC152 Antibody (NBP1-92009)

View related products by pathway.

PTMs for HPSC152 Antibody (NBP1-92009)

Learn more about PTMs related to HPSC152 Antibody (NBP1-92009).
 

Research Areas for HPSC152 Antibody (NBP1-92009)

Find related products by research area.

Blogs on HPSC152

There are no specific blogs for HPSC152, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HPSC152 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TRMT112