HPSC152 Antibody


Independent Antibodies: Western Blot: HPSC152 Antibody [NBP1-92009] - Analysis using Anti-TRMT112 antibody NBP1-92009 (A) shows similar pattern to independent antibody NBP1-92008 (B).
Immunohistochemistry-Paraffin: HPSC152 Antibody [NBP1-92009] - Staining of human adrenal gland shows nuclear and cytoplasmic positivity in glandular cells.

Product Details

Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P, IP
Validated by:

Independent Antibodies


Order Details

HPSC152 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: LIQVPKGPVEGYEENEEFLRTMHHLLLEVEVIEGTLQCPESGRMFPISRGIPNMLLSEEETES
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Immunoprecipitation
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, IP, WB reactivity reported in (PMID: 26214185).
Control Peptide
HPSC152 Protein (NBP1-92009PEP)
Read Publication using NBP1-92009.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 26214185)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for HPSC152 Antibody

  • HSPC152
  • HSPC170
  • TRM112
  • TRM112-like protein
  • TRMT11-2
  • tRNA methyltransferase 11-2 homolog (S. cerevisiae)
  • tRNA methyltransferase 112 homolog


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: ELISA, AP, PA, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, Flow-CS, Flow, IHC, IHC-P
Species: Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: ICC/IF, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
Species: Hu, Mu, Rt
Applications: IHC, KO, Simple Western, WB
Species: Hu
Applications: CyTOF-ready, Flow, IHC, WB
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
Species: Hu, Mu
Applications: CyTOF-ready, Flow, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP

Publications for HPSC152 Antibody (NBP1-92009)(1)

We have publications tested in 3 applications: ICC/IF, IP, WB.

Filter By Application
All Applications
Filter By Species
All Species

Reviews for HPSC152 Antibody (NBP1-92009) (0)

There are no reviews for HPSC152 Antibody (NBP1-92009). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for HPSC152 Antibody (NBP1-92009) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional HPSC152 Products

Bioinformatics Tool for HPSC152 Antibody (NBP1-92009)

Discover related pathways, diseases and genes to HPSC152 Antibody (NBP1-92009). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HPSC152 Antibody (NBP1-92009)

Discover more about diseases related to HPSC152 Antibody (NBP1-92009).

Pathways for HPSC152 Antibody (NBP1-92009)

View related products by pathway.

PTMs for HPSC152 Antibody (NBP1-92009)

Learn more about PTMs related to HPSC152 Antibody (NBP1-92009).

Research Areas for HPSC152 Antibody (NBP1-92009)

Find related products by research area.

Blogs on HPSC152

There are no specific blogs for HPSC152, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our HPSC152 Antibody and receive a gift card or discount.


Gene Symbol TRMT112