HPSC152 Antibody

Images

 
Independent Antibodies: Western Blot: HPSC152 Antibody [NBP1-92009] - Analysis using Anti-TRMT112 antibody NBP1-92009 (A) shows similar pattern to independent antibody NBP1-92008 (B).
Immunohistochemistry-Paraffin: HPSC152 Antibody [NBP1-92009] - Staining of human adrenal gland shows nuclear and cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IP
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
 

Independent Antibodies

       

Order Details

HPSC152 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LIQVPKGPVEGYEENEEFLRTMHHLLLEVEVIEGTLQCPESGRMFPISRGIPNMLLSEEETES
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TRMT112
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence -Reported in (PMID: 26214185)
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Immunoprecipitation -Reported in (PMID: 26214185)
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
HPSC152 Protein (NBP1-92009PEP)
Publications
Read Publication using NBP1-92009.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for HPSC152 Antibody

  • HSPC152
  • HSPC170
  • TRM112
  • TRM112-like protein
  • TRMT11-2
  • tRNA methyltransferase 11-2 homolog (S. cerevisiae)
  • tRNA methyltransferase 112 homolog

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for HPSC152 Antibody (NBP1-92009)(1)

We have publications tested in 3 applications: ICC/IF, IP, WB.


Filter By Application
ICC/IF
(1)
IP
(1)
WB
(1)
All Applications
Filter By Species
All Species

Reviews for HPSC152 Antibody (NBP1-92009) (0)

There are no reviews for HPSC152 Antibody (NBP1-92009). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for HPSC152 Antibody (NBP1-92009) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HPSC152 Products

Research Areas for HPSC152 Antibody (NBP1-92009)

Find related products by research area.

Blogs on HPSC152

There are no specific blogs for HPSC152, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HPSC152 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TRMT112