HPS6 Antibody

Images

 
Western Blot: HPS6 Antibody [NBP2-14100] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: HPS6 Antibody [NBP2-14100] - Staining of human stomach shows strong cytoplasmic and membranous positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

HPS6 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: TRGNLRLLSALGLFCVGWEAPQGVELPSAKDLVFEEACGYYQRRSLRGAQ LTPEELRHSSTFRAPQALASILQGHLPPSALLTM
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HPS6
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
HPS6 Protein (NBP2-14100PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (88%), Rat (89%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for HPS6 Antibody

  • FLJ22501
  • Hermansky-Pudlak syndrome 6 protein
  • Hermansky-Pudlak syndrome 6
  • Hermansky-Pudlak syndrome-6 protein (HPS6)
  • MGC20522
  • RP11-302K17.1
  • Ru
  • Ruby-eye protein homolog

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-31848
Species: Hu
Applications: IHC, IHC-P
NBL1-11699
Species: Hu
NBP1-92007
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89228
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-31898
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-86892
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-14357
Species: Hu
Applications: IHC, IHC-P
NBP2-25238
Species: Hu
Applications: Flow, ICC/IF, IHC-P, PAGE
NB600-1335
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, GS, ICC/IF, IHC, IHC-P, IP
NBP2-20872
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF1029
Species: Mu
Applications: WB, IHC, IP
NB100-74480
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85298
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-55573
Species: Hu
Applications: ICC/IF
NBP1-90813
Species: Hu
Applications: WB, IHC, IHC-P

Publications for HPS6 Antibody (NBP2-14100) (0)

There are no publications for HPS6 Antibody (NBP2-14100).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HPS6 Antibody (NBP2-14100) (0)

There are no reviews for HPS6 Antibody (NBP2-14100). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HPS6 Antibody (NBP2-14100) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HPS6 Products

HPS6 NBP2-14100

Bioinformatics Tool for HPS6 Antibody (NBP2-14100)

Discover related pathways, diseases and genes to HPS6 Antibody (NBP2-14100). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HPS6 Antibody (NBP2-14100)

Discover more about diseases related to HPS6 Antibody (NBP2-14100).
 

Pathways for HPS6 Antibody (NBP2-14100)

View related products by pathway.

PTMs for HPS6 Antibody (NBP2-14100)

Learn more about PTMs related to HPS6 Antibody (NBP2-14100).

Blogs on HPS6

There are no specific blogs for HPS6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HPS6 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HPS6