HOXC10 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: HOXC10 Antibody [NBP2-33699] - Immunofluorescent staining of human cell line HeLa shows localization to nuclear bodies.

Immunohistochemistry: HOXC10 Antibody [NBP2-33699] - Staining of human vulva/anal skin moderate nuclear positivity in epidermal cells.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

HOXC10 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: MTCPRNVTPNSYAEPLAAPGGGERYSRSAGMYMQSGSDFNCGVMRGCGLAPSLSKRDEGSSPSLALNTYPSYLSQLDSWGDPKAAYRLEQP
• Predicted Species: Mouse (96%), Rat (97%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: HOXC10
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  HOXC10 Protein (NBP2-33699PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for HOXC10 Antibody - BSA Free

• homeo box C10
• homeobox C10
• Homeobox protein Hox-3I
• homeobox protein Hox-C10
• homeoprotein C10
• HOX3I
• MGC5259

Background

HOXC10 is 342 amino acids long, weighing approximately 38 kDa, that functions as a sequence-specific transcription factor which focuses on the specific positional identities of cells on the anterior-posterior axis, which is all part of a developmental regulatory system. Current studies are being done on several diseases and disorders including squamous cell carcinoma, cervicitis, lung carcinoma, and neuronitis. HOXB8 has also been shown to have interactions with EGFR, CDC27, SUMO2, NUP205, and YWHAG.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: HOXC10
• Uniprot:
  • Q9NYD6(Human)