HOXB7 Antibody (4F9)


Western Blot: HOXB7 Antibody (4F9) [H00003217-M01] - Analysis of HOXB7 expression in transfected 293T cell line by HOXB7 monoclonal antibody (M01), clone 4F9.Lane 1: HOXB7 transfected lysate(23.97 KDa).Lane 2: ...read more
Sandwich ELISA: HOXB7 Antibody (4F9) [H00003217-M01] - Detection limit for recombinant GST tagged HOXB7 is approximately 0.3ng/ml as a capture antibody.

Product Details

Reactivity HuSpecies Glossary
Applications WB, ELISA

Order Details

HOXB7 Antibody (4F9) Summary

HOXB7 (NP_004493, 55 a.a. - 120 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MQGLYPGGGGMAGQSAAGVYAAGYGLEPSSFNMHCAPFEQNLSGVCPGDSAKAAGAKEQRDSDLAA
HOXB7 (4F9)
IgG1 Kappa
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot
Application Notes
Antibody reactivity against transfected lysate and recombinant protein for WB. It has been used for ELISA.
Read Publications using H00003217-M01.

Packaging, Storage & Formulations

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
PBS (pH 7.4)
No Preservative
IgG purified


Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for HOXB7 Antibody (4F9)

  • HHO.C1
  • homeo box 2C
  • homeo box B7
  • homeo box c1 protein
  • homeobox B7
  • Homeobox protein HHO.C1
  • Homeobox protein Hox-2C
  • homeobox protein Hox-B7
  • HOX2
  • Hox-2.3
  • HOX2C
  • HOX2CHox-2.3
  • HOXB7


This gene is a member of the Antp homeobox family and encodes a protein with a homeobox DNA-binding domain. It is included in a cluster of homeobox B genes located on chromosome 17. The encoded nuclear protein functions as a sequence-specific transcription factor that is involved in cell proliferation and differentiation. Increased expression of this gene is associated with some cases of melanoma and ovarian carcinoma.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ELISA
Species: Hu
Applications: WB, ELISA
Species: Hu
Applications: ICC/IF
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
Species: Hu, Mu
Applications: WB
Species: Hu, Mu
Applications: WB, PEP-ELISA
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Mu
Applications: WB, IHC
Species: Hu
Applications: ICC/IF
Species: Hu
Applications: ICC/IF
Species: Hu, Mu, Rt, Bv, Fe, Pm
Applications: WB, IHC-P
Species: Hu
Applications: WB, ICC/IF
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Species: Hu, Mu, Pm
Applications: WB

Publications for HOXB7 Antibody (H00003217-M01)(2)

Reviews for HOXB7 Antibody (H00003217-M01) (0)

There are no reviews for HOXB7 Antibody (H00003217-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HOXB7 Antibody (H00003217-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional HOXB7 Products

Bioinformatics Tool for HOXB7 Antibody (H00003217-M01)

Discover related pathways, diseases and genes to HOXB7 Antibody (H00003217-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HOXB7 Antibody (H00003217-M01)

Discover more about diseases related to HOXB7 Antibody (H00003217-M01).

Pathways for HOXB7 Antibody (H00003217-M01)

View related products by pathway.

PTMs for HOXB7 Antibody (H00003217-M01)

Learn more about PTMs related to HOXB7 Antibody (H00003217-M01).

Blogs on HOXB7

There are no specific blogs for HOXB7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our HOXB7 Antibody (4F9) and receive a gift card or discount.


Gene Symbol HOXB7