HOXB7 Antibody (4F9) - Azide and BSA Free

Western Blot: HOXB7 Antibody (4F9) [H00003217-M01] - Analysis of HOXB7 expression in transfected 293T cell line by HOXB7 monoclonal antibody (M01), clone 4F9.Lane 1: HOXB7 transfected lysate(23.97 KDa).Lane 2: Non-transfected lysate.

Sandwich ELISA: HOXB7 Antibody (4F9) [H00003217-M01] - Detection limit for recombinant GST tagged HOXB7 is approximately 0.3ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 4F9
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

HOXB7 Antibody (4F9) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: HOXB7 (NP_004493, 55 a.a. ~ 120 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MQGLYPGGGGMAGQSAAGVYAAGYGLEPSSFNMHCAPFEQNLSGVCPGDSAKAAGAKEQRDSDLAA
• Specificity: HOXB7 (4F9)
• Isotype: IgG1 Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: HOXB7
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Sandwich ELISA
  • Western Blot 1:500
• Application Notes: Antibody reactivity against transfected lysate and recombinant protein for WB. It has been used for ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for HOXB7 Antibody (4F9) - Azide and BSA Free

• HHO.C1
• homeo box 2C
• homeo box B7
• homeo box c1 protein
• homeobox B7
• Homeobox protein HHO.C1
• Homeobox protein Hox-2C
• homeobox protein Hox-B7
• HOX2
• Hox-2.3
• HOX2C
• HOX2CHox-2.3
• HOXB7

Background

This gene is a member of the Antp homeobox family and encodes a protein with a homeobox DNA-binding domain. It is included in a cluster of homeobox B genes located on chromosome 17. The encoded nuclear protein functions as a sequence-specific transcription factor that is involved in cell proliferation and differentiation. Increased expression of this gene is associated with some cases of melanoma and ovarian carcinoma.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for HOXB7 Antibody (H00003217-M01)(2)

Publications using H00003217-M01

• di Pietro M, Lao-Sirieix P, Boyle S et al. Evidence for a functional role of epigenetically regulated midcluster HOXB genes in the development of Barrett esophagus. Proc Natl Acad Sci U S A. 2012-05-17 [PMID: 22603795]
• Fernez LC, Errico MC, Bottero L et al. Oncogenic HoxB7 requires TALE cofactors is inactivated by a dominant-negative Pbx1 mutant in a cell-specific manner. Cancer Lett;266(2):144-55. 2008-08-08 [PMID: 18378073]

Bioinformatics

• Gene Symbol: HOXB7
• Entrez:
  • 3217(Human)
• OMIM:
  • 142962(Human)
• Uniprot:
  • NP_004493(Human)