HOXA6 Antibody - BSA Free

Western Blot: HOXA6 Antibody [NBP2-87588] - Host: Rabbit. Target Name: HOXA6. Sample Tissue: Mouse Pancreas lysates. Antibody Dilution: 1ug/ml

• Reactivity: Mu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

HOXA6 Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of mouse HOXA6. Peptide sequence: AVYGSHGRRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIANALCLTERQ The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: HOXA6
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for HOXA6 Antibody - BSA Free

• homeo box A6
• homeobox A6
• Homeobox protein Hox-1B
• homeobox protein HOXA6
• homeobox protein Hox-A6
• HOX1
• HOX1.2
• HOX1Bhomeo box 1B

Background

HOXA6 is 233 amino acids long, weighing approximately 26 kDa, that functions as a sequence-specific transcription factor which focuses on the specific positional identities of cells on the anterior-posterior axis, which is all part of a developmental regulatory system. HOXA4 has also been shown to have interactions with PBX1, PBX3, PKNOX2, POLR2I, and POU2F1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: HOXA6