HOXA2 Antibody


Western Blot: HOXA2 Antibody [NBP2-83053] - WB Suggested Anti-Hoxa2 Antibody. Titration: 1.0 ug/ml. Positive Control: Mouse Heart

Product Details

Reactivity MuSpecies Glossary
Applications WB

Order Details

HOXA2 Antibody Summary

The immunogen is a synthetic peptide directed towards the C-terminal region of HOXA2. Peptide sequence: MNYEFEREIGFINSQPSLAECLTSFPPVADTFQSSSIKTSTLSHSTLIPP The peptide sequence for this immunogen was taken from within the described region.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS, 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified

Alternate Names for HOXA2 Antibody

  • homeo box A2
  • homeobox A2
  • Homeobox protein Hox-1K
  • homeobox protein Hox-A2
  • HOX1K


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Po
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: WB
Species: Hu, Mu
Applications: BA
Species: Hu
Applications: ICC, WB
Species: Hu
Applications: WB
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
Species: Hu
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: CyTOF-ready, ICFlow
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC
Species: Hu
Applications: IHC, IHC-P, Simple Western, WB
Species: Hu
Applications: CyTOF-ready, Flow, ICC, WB
Species: Hu, Po
Applications: IHC-P, PEP-ELISA, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, S-ELISA, WB
Species: Hu
Applications: Flow, IHC, IHC-P, WB
Species: Mu
Applications: WB

Publications for HOXA2 Antibody (NBP2-83053) (0)

There are no publications for HOXA2 Antibody (NBP2-83053).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HOXA2 Antibody (NBP2-83053) (0)

There are no reviews for HOXA2 Antibody (NBP2-83053). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HOXA2 Antibody (NBP2-83053) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional HOXA2 Products

Bioinformatics Tool for HOXA2 Antibody (NBP2-83053)

Discover related pathways, diseases and genes to HOXA2 Antibody (NBP2-83053). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HOXA2 Antibody (NBP2-83053)

Discover more about diseases related to HOXA2 Antibody (NBP2-83053).

Pathways for HOXA2 Antibody (NBP2-83053)

View related products by pathway.

PTMs for HOXA2 Antibody (NBP2-83053)

Learn more about PTMs related to HOXA2 Antibody (NBP2-83053).

Blogs on HOXA2

There are no specific blogs for HOXA2, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our HOXA2 Antibody and receive a gift card or discount.


Gene Symbol HOXA2