Home » HOXA2 » HOXA2 Antibodies » HOXA2 Antibody

HOXA2 Antibody

 Submit a Review

Images

 
(
Enlarge)
Western Blot: HOXA2 Antibody [NBP2-83053] - WB Suggested Anti-Hoxa2 Antibody. Titration: 1.0 ug/ml. Positive Control: Mouse Heart
Western Blot: HOXA2 Antibody [NBP2-83053] - WB Suggested Anti-Hoxa2 Antibody. Titration: 1.0 ug/ml. Positive Control: Mouse Heart

Product Details

Summary
Reactivity MuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

HOXA2 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of HOXA2. Peptide sequence: MNYEFEREIGFINSQPSLAECLTSFPPVADTFQSSSIKTSTLSHSTLIPP The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
HOXA2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for HOXA2 Antibody

  • homeo box A2
  • homeobox A2
  • Homeobox protein Hox-1K
  • homeobox protein Hox-A2
  • HOX1K

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

HOXA3 Antibody
NBP1-83234
Immunocytochemistry/Immunofluorescence: HOXA3 Antibody [NBP1-83234] - Staining of human cell line U-2 OS shows localization to nucleoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: HOXA3 Antibody [NBP1-83234] - Staining of human fallopian tube shows moderate nuclear positivity in a subset of glandular cells.
Immunohistochemistry-Paraffin: HOXA3 Antibody [NBP1-83234] - Staining of human pancreas shows no nuclear positivity in exocrine glandular cells as expected.
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P
SS18L1 Antibody
NBP2-20486
Immunoprecipitation: SS18L1 Antibody [NBP2-20486] - Immunoprecipitation of CREST protein from MCF-7 whole cell extracts using 5 ug of CREST antibody [N1C2] . Western blot analysis was performed using CREST antibody [N1C2]. EasyBlot anti-Rabbit IgG was used as a secondary reagent.
Immunohistochemistry-Paraffin: SS18L1 Antibody [NBP2-20486] - Immunohistochemical analysis of paraffin-embedded Huh-7 xenograft, using antibody at 1:500 dilution.
Immunocytochemistry/Immunofluorescence: SS18L1 Antibody [NBP2-20486] - Immunofluorescence analysis of paraformaldehyde-fixed A431, using antibody at 1:500 dilution.
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
EGR2 Antibody -
BSA Free
NB110-59723
Immunocytochemistry/Immunofluorescence: EGR2 Antibody [NB110-59723] - MCF7 cells were fixed in 4% paraformaldehyde for 10 minutes and permeabilized in 0.5% Triton X-100 in PBS for 5 minutes. The cells were incubated with anti-EGR2 Antibody NB110-59723 at 2 ug/ml overnight at 4C and detected with an anti-rabbit Dylight 488 (Green) at a 1:1000 dilution for 60 minutes. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 100X objective and digitally deconvolved.
Immunohistochemistry-Paraffin: EGR2 Antibody [NB110-59723] - Analysis of a FFPE tissue section of mouse brain using 1:200 dilution of EGR2 antibody. The staining was developed using HRP labeled anti-rabbit secondary antibody and DAB reagent, and nuclei of cells were counter-stained with hematoxylin.
Western Blot: EGR2 Antibody [NB110-59723] - Detection of EGR2 in human fetal lung tissue using NB110-59723.
(1 Review)
Species: Hu, Mu, Po
Applications: ICC/IF, IHC, IHC-P, WB
HOXB2 Antibody
NBP2-83055
Western Blot: HOXB2 Antibody [NBP2-83055] - WB Suggested Anti-HOXB2 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:312500. Positive Control: HepG2 cell lysate
Western Blot: HOXB2 Antibody [NBP2-83055] - Host: Rabbit. Target Name: HOXB2. Sample Type: HepG2. Antibody Dilution: 1.0ug/ml
Western Blot: HOXB2 Antibody [NBP2-83055] - Host: Rabbit. Target Name: HOXB2. Sample Type: Jurkat. Antibody Dilution: 1.0ug/ml
Species: Hu
Applications: WB
FGF-8
[Unconjugated]
423-F8
1 μg/lane of Recombinant Human/Mouse FGF-8b was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 23 kDa.
Recombinant Human/Mouse FGF-8b (Catalog # 423-F8) stimulates cell proliferation in the NR6R‑3T3 mouse fibroblast cell line. The ED50 for this effect is 6.5-40 ng/mL in the presence of 1 μg/mL heparin.
(3 Reviews)
(55 Publications)
Species: Hu, Mu
Applications: BA
HOXA1 Antibody
AF5014
Western blot shows lysates of A431 human epithelial carcinoma cell line and A549 human lung carcinoma cell line. PVDF membrane was probed with 1 µg/mL of Goat Anti-Human HOXA1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5014) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF019). A specific band was detected for HOXA1 at approximately 35 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 8.
HOXA1 was detected in immersion fixed retinoic acid-treated NTera-2 human testicular embryonic carcinoma cell line using 10 µg/mL Goat Anti-Human HOXA1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5014) for 3 hours at room temperature. Cells were stained with the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Species: Hu
Applications: ICC, WB
CD1d Antibody
(703335)
MAB6979
Western blot shows lysates of human peripheral blood mononuclear cells (PBMC). PVDF membrane was probed with 2 µg/mL of Mouse Anti-Human CD1d Monoclonal Antibody (Catalog # MAB6979) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF007). A specific band was detected for CD1d at approximately 52 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Species: Hu
Applications: WB
Recombinant Human
Hoxb3 GST (N-Term) Pr ...
H00003213-Q01
SDS-Page: Recombinant Human Hoxb3 Protein [H00003213-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
CD82/Kai-1
Antibody (C33) - BSA
NBP2-21792
Flow Cytometry: CD82/Kai-1 Antibody (C33) [NBP2-21792] - Staining of CD82 on human peripheral blood cells with anti-CD82 (C33) APC.
Immunohistochemistry-Paraffin: CD82/Kai-1 Antibody (C33) [NBP2-21792] - Staining of human tonsil (paraffin-embedded sections) with anti-CD82 (C33).
Flow Cytometry: CD82/Kai-1 Antibody (C33) [NBP2-21792] - Flow Cytometry: [PerCP] [NBP2-21792PCP] - A cell surface (A) and intracellular stain (B) was performed on Daudi cells with CD82/Kai-1 (C33) antibody NBP2-21792PCP along with a matched isotype control NB600-986PCP. The cell surface stain was performed in an antibody dilution of 5 ug/mL and incubated at RT for 20 minutes. Prior to intracellular staining, the cells were fixed with 4% PFA and then permeablized with 0.1 % saponin. The cells were then incubated in an antibody dilution of 5 ug/mL at RT for 30 minutes. Both antibodies were conjugated to Peridinin-Chlorophyll-Protein complex. Image using the PerCP form of this antibody.
Species: Hu
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P, IP, WB
CD1e Antibody
(704407) [Unconjugate
MAB7330
Jurkat human acute T cell leukemia cell line was treated for 3 hours with monensin, then stained with Mouse Anti-Human CD1e Monoclonal Antibody (Catalog # MAB7330, filled histogram) or isotype control antibody (Catalog # MAB002, open histogram), followed by Phycoerythrin-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # F0102B).  To facilitate intracellular staining, cells were fixed with paraformaldehyde and permeabilized with saponin. 
Species: Hu
Applications: CyTOF-ready, ICFlow
RRM2 Antibody
NBP1-31661
Immunohistochemistry-Paraffin: RRM2 Antibody [NBP1-31661] - Mouse muscle. RRM2 antibody [N1C1] diluted at 1:500. Antigen Retrieval: Trilogy™ (EDTA based, pH 8.0) buffer, 15min.
Immunohistochemistry-Paraffin: RRM2 Antibody [NBP1-31661] - Rat intestine. RRM2 antibody [N1C1] iluted at 1:500. Antigen Retrieval: Citrate buffer, pH 6.0, 15 min.
Immunohistochemistry-Paraffin: RRM2 Antibody [NBP1-31661] - Mouse muscle. RRM2 antibody [N1C1] diluted at 1:500. Antigen Retrieval: Citrate buffer, pH 6.0, 15 min.
(1 Review)
(2 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
RUNX2/CBFA1
Antibody (232902) [Un ...
MAB2006
RUNX2/CBFA1 was detected in immersion fixed U2OS human osteosarcoma cell line using Rat Anti-Human RUNX2/CBFA1 Monoclonal Antibody (Catalog # MAB2006) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Rat IgG Secondary Antibody (red, upper panel; Catalog # NL013) and counterstained with DAPI (blue, lower panel). Specific staining was localized to nuclei. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(3 Reviews)
(18 Publications)
Species: Hu
Applications: ICC
HOXB1 Antibody
AF6318
HOXB1 was detected in immersion fixed NTera‑2 human testicular embryonic carcinoma cells, treated with (upper panel) and without (lower panel) retinoic acid, using Sheep Anti-Human HOXB1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF6318) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Sheep IgG Secondary Antibody (red; Catalog # NL010) and counterstained with DAPI (blue). Specific staining was localized to nuclei. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(1 Review)
Species: Hu
Applications: ICC
SATB2 Antibody
NBP1-83619
Immunohistochemistry-Paraffin: SATB2 Antibody [NBP1-83619] - Analysis in human colon and liver tissues. Corresponding SATB2 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: SATB2 Antibody [NBP1-83619] - Staining of human colon shows strong nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: SATB2 Antibody [NBP1-83619] - Staining of human cerebral cortex, colon, liver and rectum using Anti-SATB2 antibody NBP1-83619 (A) shows similar protein distribution across tissues to independent antibody NBP1-92365 (B).
(4 Publications)
Species: Hu
Applications: IHC, IHC-P, Simple Western, WB
Pref-1/DLK1/FA1
Antibody (211309)
MAB1144
Pref‑1/DLK1/FA1 was detected in immersion fixed HepG2 human hepatocellular carcinoma cell line using Mouse Anti-Human Pref‑1/DLK1/FA1 Monoclonal Antibody (Catalog # MAB1144) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). Specific staining was localized to cell membranes. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
HepG2 human hepatocellular carcinoma cell line was stained with Mouse Anti-Human Pref‑1/DLK1/FA1 Monoclonal Antibody (Catalog # MAB1144, filled histogram) or isotype control antibody (Catalog # MAB0041, open histogram), followed by Allophycocyanin-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # F0101B).
(4 Reviews)
(4 Publications)
Species: Hu
Applications: CyTOF-ready, Flow, ICC, WB
HOXA5 Antibody
NBP2-42520
Immunohistochemistry-Paraffin: HOXA5 Antibody [NBP2-42520] - Staining of paraffin embedded Human Prostate. Antibody at 5 ug/mL. Steamed antigen retrieval with citrate buffer pH 6, AP-staining.
Western Blot: HOXA5 Antibody [NBP2-42520] - Staining of Pig Kidney lysate with antibody at 1 ug/mL (35 ug protein in RIPA buffer). Primary incubation was 1 hour. Detected by chemiluminescence.
(1 Publication)
Species: Hu, Po
Applications: IHC-P, PEP-ELISA, WB
HOXA9 Antibody
NBP2-32356
Immunocytochemistry/Immunofluorescence: HOXA9 Antibody [NBP2-32356] - Staining of human cell line HEK 293 shows localization to nucleus. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: HOXA9 Antibody [NBP2-32356] - Staining of human kidney shows strong nuclear positivity in cells in glomeruli.
Immunohistochemistry-Paraffin: HOXA9 Antibody [NBP2-32356] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.
(5 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
HOXA7 Antibody
(2F2)
H00003204-M01
Western Blot: HOXA7 Antibody (2F2) [H00003204-M01] - Analysis of HOXA7 expression in transfected 293T cell line by HOXA7 monoclonal antibody (M01), clone 2F2.Lane 1: HOXA7 transfected lysate(25.4 KDa).Lane 2: Non-transfected lysate.
Sandwich ELISA: HOXA7 Antibody (2F2) [H00003204-M01] - Detection limit for recombinant GST tagged HOXA7 is approximately 0.1ng/ml as a capture antibody.
(1 Publication)
Species: Hu
Applications: ELISA, S-ELISA, WB
HOXA10 Antibody
NBP3-06103
Immunohistochemistry-Paraffin: HOXA10 Antibody [NBP3-06103] - Staining of human HOXA10 in human brain with rabbit polyclonal antibody (1:5000).
Immunohistochemistry-Paraffin: HOXA10 Antibody [NBP3-06103] - Staining of human HOXA10 in human testis with rabbit polyclonal antibody (1:5000).
Species: Hu
Applications: Flow, IHC, IHC-P, WB
HOXA2 Antibody
NBP2-83053
HOXA2 Antibody
Species: Mu
Applications: WB

Publications for HOXA2 Antibody (NBP2-83053) (0)

There are no publications for HOXA2 Antibody (NBP2-83053).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HOXA2 Antibody (NBP2-83053) (0)

There are no reviews for HOXA2 Antibody (NBP2-83053). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HOXA2 Antibody (NBP2-83053) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HOXA2 Products

Bioinformatics Tool for HOXA2 Antibody (NBP2-83053)

Discover related pathways, diseases and genes to HOXA2 Antibody (NBP2-83053). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HOXA2 Antibody (NBP2-83053)

Discover more about diseases related to HOXA2 Antibody (NBP2-83053).
 

Pathways for HOXA2 Antibody (NBP2-83053)

View related products by pathway.

PTMs for HOXA2 Antibody (NBP2-83053)

Learn more about PTMs related to HOXA2 Antibody (NBP2-83053).

Blogs on HOXA2

There are no specific blogs for HOXA2, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HOXA2 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol HOXA2