HOXA11 Antibody - BSA Free

Immunohistochemistry-Paraffin: HOXA11 Antibody [NBP1-83233] - Staining of human cerebral cortex shows no positivity in neurons as expected.

Immunohistochemistry-Paraffin: HOXA11 Antibody [NBP1-83233] - Analysis in human endometrium and cerebral cortex tissues. Corresponding HOXA11 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: HOXA11 Antibody [NBP1-83233] - Staining of human tonsil shows no positivity in germinal center cells as expected.

Immunohistochemistry-Paraffin: HOXA11 Antibody [NBP1-83233] - Staining of human testis shows weak nuclear positivity in a subset of cells in seminiferous ducts.

Immunohistochemistry-Paraffin: HOXA11 Antibody [NBP1-83233] - Staining of human endometrium shows moderate to strong nuclear positivity in cells in endometrial stroma.

Analysis in control (vector only transfected HEK293T lysate) and HOXA11 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells).

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

HOXA11 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: EVTFREYAIEPATKWHPRGNLAHCYSAEELVHRDCLQAPSAAGVPGDVLAKSSANVYHHPTPAVSSNFY
• Predicted Species: Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: HOXA11
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  HOXA11 Protein (NBP1-83233PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for HOXA11 Antibody - BSA Free

• homeo box A11
• homeobox A11
• Homeobox protein Hox-1I
• homeobox protein HOXA11
• homeobox protein Hox-A11
• HOX1
• HOX1Ihomeo box 1I

Background

In vertebrates, the genes encoding the class of transcription factors called homeobox genes are found in clusters named A, B, C, and D on four separate chromosomes. Expression of these proteins is spatially and temporally regulated during embryonic development. This gene is part of the A cluster on chromosome 7 and encodes a DNA-binding transcription factor which may regulate gene expression, morphogenesis, and differentiation. This gene is involved in the regulation of uterine development and is required for female fertility. Mutations in this gene can cause radio-ulnar synostosis with amegakaryocytic thrombocytopenia.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for HOXA11 Antibody (NBP1-83233)(1)

Publication using NBP1-83233

• Zhang, L, Dai, F Et al. Molecular mechanism of extracellular matrix disorder in pelvic organ prolapses. Mol Med Rep 2020-12-01 [PMID: 33173982] (FLOW, Rat)
  
  Details:
  Citation using the PE format of this antibody.

Bioinformatics

• Gene Symbol: HOXA11