HOXA11 Antibody


Western Blot: HOXA11 Antibody [NBP1-83233] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed ...read more
Immunohistochemistry-Paraffin: HOXA11 Antibody [NBP1-83233] - Staining of human corpus, uterine shows moderate nuclear positivity in endometrial stromal cells.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

HOXA11 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids:EVTFREYAIEPATKWHPRGNLAHCYSAEELVHRDCLQAPSAAGVPGDVLAKSSANVYHHPTPAVSSNFY
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
HOXA11 Protein (NBP1-83233PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for HOXA11 Antibody

  • homeo box A11
  • homeobox A11
  • Homeobox protein Hox-1I
  • homeobox protein HOXA11
  • homeobox protein Hox-A11
  • HOX1
  • HOX1Ihomeo box 1I


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Species: Hu
Applications: WB, ICC/IF
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
Species: Hu, Mu, Rt, Ch, Fe, Pm
Applications: WB
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB
Species: Hu
Applications: WB, IHC, ICC
Species: Hu
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: WB, ICC
Species: Hu
Applications: ICC/IF
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, IHC-P

Publications for HOXA11 Antibody (NBP1-83233) (0)

There are no publications for HOXA11 Antibody (NBP1-83233).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HOXA11 Antibody (NBP1-83233) (0)

There are no reviews for HOXA11 Antibody (NBP1-83233). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HOXA11 Antibody (NBP1-83233) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional HOXA11 Products

Bioinformatics Tool for HOXA11 Antibody (NBP1-83233)

Discover related pathways, diseases and genes to HOXA11 Antibody (NBP1-83233). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HOXA11 Antibody (NBP1-83233)

Discover more about diseases related to HOXA11 Antibody (NBP1-83233).

Pathways for HOXA11 Antibody (NBP1-83233)

View related products by pathway.

PTMs for HOXA11 Antibody (NBP1-83233)

Learn more about PTMs related to HOXA11 Antibody (NBP1-83233).

Blogs on HOXA11

There are no specific blogs for HOXA11, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our HOXA11 Antibody and receive a gift card or discount.


Gene Symbol HOXA11