HOXA1 Antibody - Azide and BSA Free

Western Blot: HOXA1 Antibody [H00003198-B01P] - Analysis of HOXA1 expression in transfected 293T cell line by HOXA1 polyclonal antibody. Lane 1: HOXA1 transfected lysate(36.85 KDa). Lane 2: Non-transfected lysate.

Immunocytochemistry/Immunofluorescence: HOXA1 Antibody [H00003198-B01P] - Analysis of purified antibody to HOXA1 on HeLa cell. (antibody concentration 10 ug/ml)

• Reactivity: Hu
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

HOXA1 Antibody - Azide and BSA Free Summary

• Description: Quality control test: Antibody reactive against mammalian transfected lysate.
• Immunogen: HOXA1 (NP_005513.1, 1 a.a. - 335 a.a.) full-length human protein. MDNARMNSFLEYPILSSGDSGTCSARAYPSDHRITTFQSCAVSANSCGGDDRFLVGRGVQIGSPHHHHHHHHHHPQPATYQTSGNLGVSYSHSSCGPSYGSQNFSAPYSPYALNQEADVSGGYPQCAPAVYSGNLSSPMVQHHHHHQGYAGGAVGSPQYIHHSYGQEHQSLALATYNNSLSPLHASHQEACRSPASETSSPAQTFDWMKVKRNPPKTGKVGEYGYLGQPNAVRTNFTTKQLTELEKEFHFNKYLTRARRVEIAASLQLNETQVKIWFQNRRMKQKKREKEGLLPISPATPPGNDEKAEESSEKSSSSPCVPSPGSSTSDTLTTSH
• Specificity: HOXA1 - homeobox A1,
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: HOXA1
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence
  • Western Blot 1:500
• Application Notes: Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control. It has been used for IF.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for HOXA1 Antibody - Azide and BSA Free

• BSAS
• homeo box A1
• homeobox A1
• Homeobox protein Hox-1F
• homeobox protein Hox-A1
• Hox 1.6-like protein
• HOX A1 homeodomain protein
• HOX1
• HOX1F
• HOX1Fhomeobox 1F
• HOXA1
• lab-like protein
• MGC45232

Background

In vertebrates, the genes encoding the class of transcription factors called homeobox genes are found in clusters named A, B, C, and D on four separate chromosomes. Expression of these proteins is spatially and temporally regulated during embryonic development. This gene is part of the A cluster on chromosome 7 and encodes a DNA-binding transcription factor which may regulate gene expression, morphogenesis, and differentiation. The encoded protein may be involved in the placement of hindbrain segments in the proper location along the anterior-posterior axis during development. Two transcript variants encoding two different isoforms have been found for this gene, with only one of the isoforms containing the homeodomain region. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for HOXA1 Antibody (H00003198-B01P)(1)

Publication using H00003198-B01P

• Scott KL, Nogueira C, Heffernan TP et al. Proinvasion metastasis drivers in early-stage melanoma are oncogenes. Cancer Cell 2011-07-12 [PMID: 21741599]

Bioinformatics

• Gene Symbol: HOXA1
• Entrez:
  • 3198(Human)
• Uniprot:
  • NP_005513.1(Human)