HOXA1 Antibody (1E10.)

Images

 
Sandwich ELISA: HOXA1 Antibody (1E10) [H00003198-M01] - Detection limit for recombinant GST tagged HOXA1 is 0.3 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
1E10.
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

HOXA1 Antibody (1E10.) Summary

Immunogen
HOXA1 (NP_005513.1, 11 a.a. - 119 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. EYPILSSGDSGTCSARAYPSDHRITTFQSCAVSANSCGGDDRFLVGRGVQIGSPHHHHHHHHHHPQPATYQTSGNLGVSYSHSSCGPSYGSQNFSAPYSPYALNQEADV
Specificity
Reacts with homeobox A1.
Isotype
IgG3 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
HOXA1
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
This antibody is reactive against recombinant protein in WB and ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for HOXA1 Antibody (1E10.)

  • BSAS
  • homeo box A1
  • homeobox A1
  • Homeobox protein Hox-1F
  • homeobox protein Hox-A1
  • Hox 1.6-like protein
  • HOX A1 homeodomain protein
  • HOX1
  • HOX1F
  • HOX1Fhomeobox 1F
  • HOXA1
  • lab-like protein
  • MGC45232

Background

In vertebrates, the genes encoding the class of transcription factors called homeobox genes are found in clusters named A, B, C, and D on four separate chromosomes. Expression of these proteins is spatially and temporally regulated during embryonic development. This gene is part of the A cluster on chromosome 7 and encodes a DNA-binding transcription factor which may regulate gene expression, morphogenesis, and differentiation. The encoded protein may be involved in the placement of hindbrain segments in the proper location along the anterior-posterior axis during development. Two transcript variants encoding two different isoforms have been found for this gene, with only one of the isoforms containing the homeodomain region. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF6318
Species: Hu
Applications: ICC
NB110-59723
Species: Hu, Mu, Po
Applications: WB, ICC/IF, IF
H00005087-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-20486
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-64852
Species: Hu
Applications: Flow, IHC, IHC-Fr
NBP2-16061
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-33581
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
NB100-314
Species: Hu
Applications: WB, IP, PLA
H00003206-R02
Species: Hu
NBP2-58865
Species: Hu
Applications: ICC/IF
NB200-322
Species: Hu, Mu, Rt
Applications: WB, IHC-Fr
NBP2-58710
Species: Hu
Applications: WB, ICC/IF
NBP1-87158
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NBP1-07100
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-83234
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-56905
Species: Hu
Applications: WB, ICC/IF
NBP2-55738
Species: Hu
Applications: ICC/IF
NBP2-49631
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-81776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for HOXA1 Antibody (H00003198-M01) (0)

There are no publications for HOXA1 Antibody (H00003198-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HOXA1 Antibody (H00003198-M01) (0)

There are no reviews for HOXA1 Antibody (H00003198-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HOXA1 Antibody (H00003198-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HOXA1 Products

Bioinformatics Tool for HOXA1 Antibody (H00003198-M01)

Discover related pathways, diseases and genes to HOXA1 Antibody (H00003198-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HOXA1 Antibody (H00003198-M01)

Discover more about diseases related to HOXA1 Antibody (H00003198-M01).
 

Pathways for HOXA1 Antibody (H00003198-M01)

View related products by pathway.

PTMs for HOXA1 Antibody (H00003198-M01)

Learn more about PTMs related to HOXA1 Antibody (H00003198-M01).

Blogs on HOXA1

There are no specific blogs for HOXA1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

HOXA10 RNAi
H00003206-R02-20nmol

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HOXA1 Antibody (1E10.) and receive a gift card or discount.

Bioinformatics

Gene Symbol HOXA1
Entrez
Uniprot