HNRNPUL1 Recombinant Protein Antigen

Images

 
There are currently no images for HNRNPUL1 Protein (NBP2-47432PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

HNRNPUL1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human HNRNPUL1.

Source: E.coli

Amino Acid Sequence: NESGYERRPLEMEQQQAYRPEMKTEMKQGAPTSFLPPEASQLKPDRQQFQSRKRPYEENRGRGYFEHREDRRGRSPQPPAEEDE

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
HNRNPUL1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-47432.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for HNRNPUL1 Recombinant Protein Antigen

  • Adenovirus early region 1B-associated protein 5
  • E1B-AP5E1B 55kDa associated protein 5
  • E1BAP5E1B-55 kDa-associated protein 5
  • FLJ12944
  • heterogeneous nuclear ribonucleoprotein U-like 1
  • heterogeneous nuclear ribonucleoprotein U-like protein 1
  • HNRPUL1E1B-55kDa-associated protein 5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-88317
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB120-6125
Species: Hu, Bv, Ca, Pm, Xp, Dr(-), Mu(-)
Applications: WB, ELISA, Flow, ICC/IF, IP, MiAr, CyTOF-ready
NBP1-57160
Species: Hu
Applications: WB, IHC, IHC-P, KD
MAB6798
Species: Hu
Applications: WB, ICC
NB100-384
Species: Hu, Mu, Rt, Ca
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-02004
Species: Hu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-2204
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP1-23017
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-67074
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
NBP2-01291
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38806
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31336
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
H00388112-B01P
Species: Hu
Applications: WB, ELISA
NLS3775
Species: Hu, Mk
Applications: ICC/IF, IHC-P
NB100-79810
Species: Hu, Mu
Applications: WB, ICC/IF, IP
NB100-1894
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA

Publications for HNRNPUL1 Protein (NBP2-47432PEP) (0)

There are no publications for HNRNPUL1 Protein (NBP2-47432PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HNRNPUL1 Protein (NBP2-47432PEP) (0)

There are no reviews for HNRNPUL1 Protein (NBP2-47432PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for HNRNPUL1 Protein (NBP2-47432PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for HNRNPUL1 Protein (NBP2-47432PEP)

Discover related pathways, diseases and genes to HNRNPUL1 Protein (NBP2-47432PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HNRNPUL1 Protein (NBP2-47432PEP)

Discover more about diseases related to HNRNPUL1 Protein (NBP2-47432PEP).
 

Pathways for HNRNPUL1 Protein (NBP2-47432PEP)

View related products by pathway.

PTMs for HNRNPUL1 Protein (NBP2-47432PEP)

Learn more about PTMs related to HNRNPUL1 Protein (NBP2-47432PEP).

Blogs on HNRNPUL1

There are no specific blogs for HNRNPUL1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

HNRNPUL1 Antibody
NB110-40586
p19ARF Antibody
NB200-106

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our HNRNPUL1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol HNRNPUL1