hnRNP M1-M4 Recombinant Protein Antigen

Images

 
There are currently no images for hnRNP M1-M4 Protein (NBP1-84555PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

hnRNP M1-M4 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human HNRNPM.

Source: E. coli

Amino Acid Sequence: NKMGGMEGPFGGGMENMGRFGSGMNMGRINEILSNALKRGEIIAKQGGGGGGGSVPGIERMGPGIDRLGGAGMERMGAGLGHGMDRVGSEIERMGLVMDRMGSVE

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
HNRNPM
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-84555.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for hnRNP M1-M4 Recombinant Protein Antigen

  • DKFZp547H118
  • heterogeneous nuclear ribonucleoprotein M
  • hnRNP M
  • HNRNPM4
  • HNRPM4heterogenous nuclear ribonucleoprotein M
  • HNRPMheterogenous nuclear ribonucleoprotein M4
  • HTGR1
  • M4 protein
  • N-acetylglucosamine receptor 1
  • NAGR1hnRNA-binding protein M4

Background

Proteins that directly bind to nascent RNA polymerase II transcripts, the heterogenous nuclear ribonucleoproteins (hnRNPs), play an important role in both transcript-specific packaging and alternative splicing of pre-mRNAs. A group of abundant hnRNPs, the M1-M4 proteins, appear as a cluster of four proteins. The M proteins are pre-mRNA binding proteins in vivo, and they bind avidly to poly (G) and poly (U) RNA homopolymers in vitro. M proteins are members of the ribonucleoprotein consensus sequence family of RNA-binding proteins with greatest similarity to a hypothetical RNA-binding protein from Saccharomyces cerevisiae. The M proteins also possess an unusual hexapeptide-repeat region rich in methionine and arginine residues (MR repeat motif) that resembles a repeat in the 64kDa subunit of cleavage stimulation factor, which is involved in 3'-end maturation of pre-mRNAs. Proteins immunologically related to M exist in divergent eukaryotes ranging from human to yeast.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

M6000B
Species: Mu
Applications: ELISA
MAB41281
Species: Hu
Applications: CyTOF-ready, Flow, IHC, WB
NBP2-36776
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NB100-1556
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, WB
AF4478
Species: Hu
Applications: IHC, WB
NBP2-38806
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP3-41306
Species: Hu, Mu, Rt
Applications: WB
NBP3-33527
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, WB
DY417
Species: Mu
Applications: ELISA
NBP2-49612
Species: Hu
Applications: ChIP-EXO-SEQ, ICC/IF, IHC,  IHC-P
NBP3-25443
Species: Hu, Mu, Rt
Applications: Flow, Func, ICC/IF, IHC,  IHC-P, WB
NBP1-77397
Species: Hu, Mu
Applications: Flow, IB, ICC/IF, IHC,  IHC-P, KD, Simple Western, WB
NBP3-16607
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP2-15939
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NB120-2788
Species: Bv, Fe, Fi, Ha, Hu, Mu, Pm, Rt
Applications: B/N, Flow, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, Simple Western, WB
NBP1-81696
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-84555PEP
Species: Hu
Applications: AC

Publications for hnRNP M1-M4 Protein (NBP1-84555PEP) (0)

There are no publications for hnRNP M1-M4 Protein (NBP1-84555PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for hnRNP M1-M4 Protein (NBP1-84555PEP) (0)

There are no reviews for hnRNP M1-M4 Protein (NBP1-84555PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for hnRNP M1-M4 Protein (NBP1-84555PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional hnRNP M1-M4 Products

Research Areas for hnRNP M1-M4 Protein (NBP1-84555PEP)

Find related products by research area.

Blogs on hnRNP M1-M4

There are no specific blogs for hnRNP M1-M4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our hnRNP M1-M4 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol HNRNPM