hnRNP M Antibody (3F7)

Images

 
Western Blot: hnRNP M Antibody (3F7) [H00004670-M03] - Analysis of HNRPM expression in NIH/3T3 (Cat # L018V1).
Immunocytochemistry/ Immunofluorescence: hnRNP M Antibody (3F7) [H00004670-M03] - Analysis of monoclonal antibody to HNRPM on HepG2 cell. Antibody concentration 10 ug/ml
Immunohistochemistry-Paraffin: hnRNP M Antibody (3F7) [H00004670-M03] - Analysis of monoclonal antibody to HNRPM on formalin-fixed paraffin-embedded human thyroid nodular goiter. Antibody concentration 3 ug/ml
Western Blot: hnRNP M Antibody (3F7) [H00004670-M03] - Analysis of HNRPM expression in PC-12 (Cat # L012V1).
Western Blot: hnRNP M Antibody (3F7) [H00004670-M03] - Analysis of HNRPM expression in HepG2 (Cat # L019V1).
ELISA: hnRNP M Antibody (3F7) [H00004670-M03] - Detection limit for recombinant GST tagged HNRPM is approximately 0.1ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
Clone
3F7
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

hnRNP M Antibody (3F7) Summary

Immunogen
HNRPM (NP_005959, 17 a.a. ~ 112 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KMEEESGAPGVPSGNGAPGPKGEGERPAQNEKRKEKNIKRGGNRFEPYANPTKRYRAFITNIPFDVKWQSLKDLVKEKVGEVTYVELLMDAEGKSR
Specificity
HNRPM - heterogeneous nuclear ribonucleoprotein M
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
HNRNPM
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Sandwich ELISA
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF, IHC-P and ELISA.
Publications
Read Publication using H00004670-M03.

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for hnRNP M Antibody (3F7)

  • DKFZp547H118
  • heterogeneous nuclear ribonucleoprotein M
  • hnRNP M
  • HNRNPM4
  • HNRPM4heterogenous nuclear ribonucleoprotein M
  • HNRPMheterogenous nuclear ribonucleoprotein M4
  • HTGR1
  • M4 protein
  • N-acetylglucosamine receptor 1
  • NAGR1hnRNA-binding protein M4

Background

This gene belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. The protein encoded by this gene has three repeats of quasi-RRM domains that bind to RNAs. This protein also constitutes a monomer of the N-acetylglucosamine-specific receptor which is postulated to trigger selective recycling of immature GlcNAc-bearing thyroglobulin molecules. Multiple alternatively spliced transcript variants are known for this gene but only two transcripts has been isolated.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34594
Species: Hu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready
NBP2-67656
Species: Hu, Mu, Rt, Ze
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NB100-1556
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP, ICC
AF4478
Species: Hu
Applications: WB, IHC
NBP1-57156
Species: Hu
Applications: WB, IHC, IHC-P
H00006421-M02
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
NB120-3446
Species: Hu, Mu, Rt, Ca, Ha, Rb
Applications: WB, ChIP, GS, ICC/IF, IHC, IHC-P, IP, KD
NBP2-27419
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NLS1403
Species: Hu
Applications: IHC, IHC-P
NBP1-77397
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IB, ICC/IF, IHC, IHC-P, KD
AF4530
Species: Hu
Applications: WB, IHC, ICC
NBP2-15939
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB120-2788
Species: Hu, Mu, Rt, Bv, Fe, Fi, Ha, Pm
Applications: WB, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, B/N
NBP2-67817
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P

Publications for hnRNP M Antibody (H00004670-M03)(1)

Reviews for hnRNP M Antibody (H00004670-M03) (0)

There are no reviews for hnRNP M Antibody (H00004670-M03). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for hnRNP M Antibody (H00004670-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional hnRNP M Products

Bioinformatics Tool for hnRNP M Antibody (H00004670-M03)

Discover related pathways, diseases and genes to hnRNP M Antibody (H00004670-M03). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for hnRNP M Antibody (H00004670-M03)

Discover more about diseases related to hnRNP M Antibody (H00004670-M03).
 

Pathways for hnRNP M Antibody (H00004670-M03)

View related products by pathway.

PTMs for hnRNP M Antibody (H00004670-M03)

Learn more about PTMs related to hnRNP M Antibody (H00004670-M03).
 

Research Areas for hnRNP M Antibody (H00004670-M03)

Find related products by research area.

Blogs on hnRNP M

There are no specific blogs for hnRNP M, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our hnRNP M Antibody (3F7) and receive a gift card or discount.

Bioinformatics

Gene Symbol HNRNPM
Entrez
OMIM
Uniprot