HNF-4 gamma/NR2A2 Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human HNF4G. Source: E. coli
Amino Acid Sequence: WQMIEQIQFVKLFGMVKIDNLLQEMLLGGASNDGSHLHHPMHPHLSQDPLTGQTILLGPMSTLVHADQISTPETPLPSPPQGSGQEQYKIAANQASVISHQHLSKQKQ Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
HNF4G |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10 - 100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-82531. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW |
29 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for HNF-4 gamma/NR2A2 Recombinant Protein Antigen
Background
Hepatocyte nuclear factor 4 gamma (HNF4 gamma) is a NR2 Hepatocyte NF4-Like receptor of relatively unknown function. Although HNF4 gamma is structurally related to HNF4 alpha and is expressed together with HNF 4 Alpha in pancreatic islets, it does not play a major role in the etiology of early onset, autosomal dominant, non insulin-dependent type 2 diabetes or maturity-onset diabetes of the young, MODY1. A pseudogene of HNF4 gamma, located on chromosome 13 (13q14.11 - 13q14.3), has been recently identified using a comparative genomics approach. HNF4 gamma expression has been reported human pancreas, kidney, testis, small intestine, and colon. ESTs have been isolated from human tissue libraries, including cancerous brain and colon, and normal brain,stomach, and liver.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 3 months from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ChIP-EXO-SEQ, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: ICC, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, PAGE, WB
Species: Hu, Mu
Applications: ChIP, ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
Species: Hu
Applications: ChIP, ICC, IHC, WB
Species: Hu
Applications: Simple Western, WB
Species: Hu
Applications: EnzAct
Species: Hu
Applications: ICC, WB
Species: Hu
Applications: Dual ISH-IHC, ICC, IHC, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
Species: Am, Ca, Gp, Hu, Mu, Po, Rb, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
Species: Bv, Ca, Ch, ChHa, Eq, Gp, Hu, Mu, Ma-Op, Po, Pm, Rb, Rt, RM, Ze
Applications: IHC, IHC-P, KD, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: AC
Publications for HNF-4 gamma/NR2A2 Protein (NBP1-82531PEP) (0)
There are no publications for HNF-4 gamma/NR2A2 Protein (NBP1-82531PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for HNF-4 gamma/NR2A2 Protein (NBP1-82531PEP) (0)
There are no reviews for HNF-4 gamma/NR2A2 Protein (NBP1-82531PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for HNF-4 gamma/NR2A2 Protein (NBP1-82531PEP) (0)
Additional HNF-4 gamma/NR2A2 Products
Blogs on HNF-4 gamma/NR2A2