HNF-4 gamma/NR2A2 Recombinant Protein Antigen

Images

 
There are currently no images for HNF-4 gamma/NR2A2 Protein (NBP1-82531PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

HNF-4 gamma/NR2A2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human HNF4G.

Source: E. coli

Amino Acid Sequence: WQMIEQIQFVKLFGMVKIDNLLQEMLLGGASNDGSHLHHPMHPHLSQDPLTGQTILLGPMSTLVHADQISTPETPLPSPPQGSGQEQYKIAANQASVISHQHLSKQKQ

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
HNF4G
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-82531.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for HNF-4 gamma/NR2A2 Recombinant Protein Antigen

  • hepatocyte nuclear factor 4, gamma
  • hepatocyte nuclear factor 4-gamma
  • HNF4 gamma
  • HNF-4 gamma
  • HNF4G
  • HNF-4-gamma
  • NR2A2
  • NR2A2Nuclear receptor subfamily 2 group A member 2
  • NR2A3

Background

Hepatocyte nuclear factor 4 gamma (HNF4 gamma) is a NR2 Hepatocyte NF4-Like receptor of relatively unknown function. Although HNF4 gamma is structurally related to HNF4 alpha and is expressed together with HNF 4 Alpha in pancreatic islets, it does not play a major role in the etiology of early onset, autosomal dominant, non insulin-dependent type 2 diabetes or maturity-onset diabetes of the young, MODY1. A pseudogene of HNF4 gamma, located on chromosome 13 (13q14.11 - 13q14.3), has been recently identified using a comparative genomics approach. HNF4 gamma expression has been reported human pancreas, kidney, testis, small intestine, and colon. ESTs have been isolated from human tissue libraries, including cancerous brain and colon, and normal brain,stomach, and liver.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89679
Species: Hu
Applications: ChIP-EXO-SEQ, ICC/IF, IHC,  IHC-P, WB
AF4186
Species: Hu
Applications: ICC, WB
NBP1-33596
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, PAGE, WB
NBP1-89680
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, Simple Western, WB
NBP3-35145
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
H00001109-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, S-ELISA, WB
AF2400
Species: Hu
Applications: ChIP, ICC, IHC, WB
MAB6529
Species: Hu
Applications: Simple Western, WB
NBP1-31378
Species: Hu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, WB
AF6277
Species: Hu
Applications: ICC, WB
AF2419
Species: Hu
Applications: Dual ISH-IHC, ICC, IHC, Simple Western, WB
NBP3-48016
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
NB300-581
Species: Am, Ca, Gp, Hu, Mu, Po, Rb, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, Simple Western, WB
NBP2-27196
Species: Bv, Ca, Ch, ChHa, Eq, Gp, Hu, Mu, Ma-Op, Po, Pm, Rb, Rt, RM, Ze
Applications: IHC,  IHC-P, KD, WB
NBP1-84079
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-87461
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
NBP2-45269
Species: Hu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-82531PEP
Species: Hu
Applications: AC

Publications for HNF-4 gamma/NR2A2 Protein (NBP1-82531PEP) (0)

There are no publications for HNF-4 gamma/NR2A2 Protein (NBP1-82531PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HNF-4 gamma/NR2A2 Protein (NBP1-82531PEP) (0)

There are no reviews for HNF-4 gamma/NR2A2 Protein (NBP1-82531PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for HNF-4 gamma/NR2A2 Protein (NBP1-82531PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional HNF-4 gamma/NR2A2 Products

Blogs on HNF-4 gamma/NR2A2

There are no specific blogs for HNF-4 gamma/NR2A2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our HNF-4 gamma/NR2A2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol HNF4G