HMGCL Antibody

Images

 
Western Blot: HMGCL Antibody [NBP1-83251] - Lane 1: Marker [kDa] 229, 112, 84, 48, 32, 27, 17. Lane 2: Human cell line RT-4
Immunohistochemistry-Paraffin: HMGCL Antibody [NBP1-83251] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

HMGCL Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:GLQNEKNIVSTPVKIKLIDMLSEAGLSVIETTSFVSPKWVPQMGDHTEVLKGIQKFPGINYPVLTPNLKGFEAAVAAGAKEVVIFGAASELFTKKNINCSIEESFQRFDAILKAAQSANISVRGYVSCALGCPYEGKISPAK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HMGCL
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
HMGCL Protein (NBP1-83251PEP)
Publications
Read Publication using NBP1-83251.

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (84%), Rat (86%). Reactivity reported in scientific literature (PMID: 23082721)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for HMGCL Antibody

  • 3-hydroxy-3-methylglutaryl-CoA lyase
  • 3-hydroxymethyl-3-methylglutaryl-CoA lyase
  • EC 4.1.3.4
  • HLmitochondrial

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF7197
Species: Hu, Mu
Applications: WB, IHC, ICC
NBL1-12547
Species: Hu
NBP1-88057
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB300-558
Species: Hu, Rb
Applications: WB, ELISA, ICC/IF, IP
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-52979
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-57016
Species: Hu
Applications: WB
H00003077-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-30981
Species: Hu, Mu
Applications: WB, ICC/IF
AF5535
Species: Hu
Applications: WB, Simple Western
NB400-118
Species: Hu, Mu(-)
Applications: WB, ELISA, ICC/IF
AF2009
Species: Hu
Applications: WB, IHC
NB200-541
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
NBP1-26612
Species: Hu
Applications: IP (-), WB
MAB24601
Species: Hu
Applications: WB, IP, Neut
NBP1-83251
Species: Hu
Applications: WB, IHC, IHC-P

Publications for HMGCL Antibody (NBP1-83251)(1)

Reviews for HMGCL Antibody (NBP1-83251) (0)

There are no reviews for HMGCL Antibody (NBP1-83251). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HMGCL Antibody (NBP1-83251) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HMGCL Products

Bioinformatics Tool for HMGCL Antibody (NBP1-83251)

Discover related pathways, diseases and genes to HMGCL Antibody (NBP1-83251). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HMGCL Antibody (NBP1-83251)

Discover more about diseases related to HMGCL Antibody (NBP1-83251).
 

Pathways for HMGCL Antibody (NBP1-83251)

View related products by pathway.

PTMs for HMGCL Antibody (NBP1-83251)

Learn more about PTMs related to HMGCL Antibody (NBP1-83251).

Blogs on HMGCL

There are no specific blogs for HMGCL, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HMGCL Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HMGCL