HMGCL Antibody - BSA Free

Immunohistochemistry-Paraffin: HMGCL Antibody [NBP1-83251] - Staining in human liver and skin tissues using anti-HMGCL antibody. Corresponding HMGCL RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: HMGCL Antibody [NBP1-83251] - Staining of human liver shows high expression.

Immunohistochemistry-Paraffin: HMGCL Antibody [NBP1-83251] - Staining of human skin shows low expression as expected.

Lane 1: Marker [kDa] 229, 112, 84, 48, 32, 27, 17Lane 2: Human cell line RT-4

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

HMGCL Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit HMGCL Antibody - BSA Free (NBP1-83251) is a polyclonal antibody validated for use in IHC and WB. Anti-HMGCL Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: GLQNEKNIVSTPVKIKLIDMLSEAGLSVIETTSFVSPKWVPQMGDHTEVLKGIQKFPGINYPVLTPNLKGFEAAVAAGAKEVVIFGAASELFTKKNINCSIEESFQRFDAILKAAQSANISVRGYVSCALGCPYEGKISPAK
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: HMGCL
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  HMGCL Protein (NBP1-83251PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (84%), Rat (86%). Reactivity reported in scientific literature (PMID: 23082721)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for HMGCL Antibody - BSA Free

• 3-hydroxy-3-methylglutaryl-CoA lyase
• 3-hydroxymethyl-3-methylglutaryl-CoA lyase
• EC 4.1.3.4
• HLmitochondrial

Background

The protein encoded by the HMGCL gene belongs to the HMG-CoA lyase family. It is a mitochondrial enzyme that catalyzes thefinal step of leucine degradation and plays a key role in ketone body formation. Mutations in this gene are associatedwith HMG-CoA lyase deficiency. Alternatively spliced transcript variants encoding different isoforms have been foundfor this gene. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for HMGCL Antibody (NBP1-83251)(1)

Publication using NBP1-83251

• Martinez-Outschoorn UE, Lin Z, Whitaker-Menezes D et al. Ketone bodies and two-compartment tumor metabolism: Stromal ketone production fuels mitochondrial biogenesis in epithelial cancer cells. Cell Cycle 2012-11-01 [PMID: 23082721]

Bioinformatics

• Gene Symbol: HMGCL