HLTF Antibody [HRP]

Product Discontinued

HLTF Antibody [HRP] Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 726-1009 of human HLTF (NP_620636.1).
  
  Sequence:
  VSSNGPSGNDTPEELRKKLIRKMKLILSSGSDEECAICLDSLTVPVITHCAHVFCKPCICQVIQNEQPHAKCPLCRNDIHEDNLLECPPEELARDSEKKSDMEWTSSSKINALMHALTDLRKKNPNIKSLVVSQFTTFLSLIEIPLKASGFVFTRLDGSMAQKKRVESIQCFQNTEAGSPTIMLLSLKAGGVGLNLSAASRVFLMDPAWNPAAEDQCFDRCHRLGQKQEVIITKFIVKDSVEENMLKIQNKKRELAAGAFGTKKPNADEMKQAKINEIRTLIDL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: HLTF
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot
• Application Notes: Optimal dilution of this antibody should be experimentally determined.

Packaging, Storage & Formulations

• Storage: Store at 4C in the dark.
• Buffer: PBS
• Preservative: No Preservative
• Purity: Affinity purified

Alternate Names for HLTF Antibody [HRP]

• DNA-binding protein/plasminogen activator inhibitor 1 regulator
• EC 3.6.1
• EC 3.6.4.-
• EC 6.3.2.-
• helicase-like transcription factor
• HIP116ARING finger protein 80
• HIP116matrix associated, actin dependent regulator of chromatin
• RNF80SWI/SNF-related matrix-associated actin-dependent regulator of chromatinsubfamily A member 3
• subfamily a, member 3
• Sucrose nonfermenting protein 2-like 3
• ZBU1

Background

Helicase-like Transcription Factor (HLTF) is a member of the the SWI/SNF family of nuclear enzymes that remove proteins that coil around DNA. Members of this family have helicase and ATPase activities and are thought to regulate transcription of certain genes by altering the chromatin structure around those genes. HLTF proteins aid the stabilization and regulation of the production of proteins in the cell. Inactivation of the HTLF gene may contribute to the transformation of normal colon cells into cancer cells.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: HLTF