HLA DRB1 Antibody

Western Blot: HLA DRB1 Antibody [H00003123-B02P] - Analysis of HLA-DRB1 expression in human spleen.

Western Blot: HLA DRB1 Antibody [H00003123-B02P] - Analysis of HLA-DRB1 expression in transfected 293T cell line by HLA-DRB1 polyclonal antibody. Lane 1: HLA-DRB1 transfected lysate(29.26 KDa). Lane 2: Non-transfected lysate.

Product Discontinued

HLA DRB1 Antibody Summary

• Description: Quality control test: Antibody reactive against mammalian transfected lysate.
• Immunogen: HLA-DRB1 (AAH33827.1, 1 a.a. - 266 a.a.) full-length human protein. MVCLKLPGGSCMTALTVTLMVLSSPLALSGDTRPRFLWQPKRECHFFNGTERVRFLDRYFYNQEESVRFDSDVGEFRAVTELGRPDAEYWNSQKDILEQARAAVDTYCRHNYGVVESFTVQRRVQPKVTVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFLNGQEEKAGMVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYFRNQKGHSGLQPTGFLS
• Specificity: HLA-DRB1 - major histocompatibility complex, class II, DR beta 1,
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: HLA-DRB1
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Flow Cytometry
  • Western Blot
• Application Notes: Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for HLA DRB1 Antibody

• Clone P2-beta-3
• DR1
• DR-1
• DR12
• DR-12
• DR13
• DR-13
• DR14
• DR-14
• DR16
• DR-16
• DR4
• DR-4
• DR5
• DR-5
• DR7
• DR-7
• DR8
• DR-8
• DR9
• DR-9
• DRB1
• DRw10
• DRw11
• DRw8
• DW2.2/DR2.2
• FLJ75017
• FLJ76359
• HLA class II antigen beta chain
• HLA class II histocompatibility antigen, DR-1 beta chain
• HLA-DR1B
• HLA-DRB
• HLA-DRB1
• HLA-DRB1*
• HLA-DRB2
• HLA-DR-beta 1
• human leucocyte antigen DRB1
• leucocyte antigen DR beta 1 chain
• leucocyte antigen DRB1
• lymphocyte antigen DRB1
• major histocompatibility complex, class II, DR beta 1
• MHC class II antigen DRB1*1
• MHC class II antigen DRB1*10
• MHC class II antigen DRB1*11
• MHC class II antigen DRB1*12
• MHC class II antigen DRB1*13
• MHC class II antigen DRB1*14
• MHC class II antigen DRB1*15
• MHC class II antigen DRB1*16
• MHC class II antigen DRB1*3
• MHC class II antigen DRB1*4
• MHC class II antigen DRB1*7
• MHC class II antigen DRB1*8
• MHC class II antigen DRB1*9
• MHC class II antigen HLA-DR13
• MHC class II HLA-DR beta 1 chain
• MHC class II HLA-DR-beta cell surface glycoprotein
• MHC class II HLA-DRw10-beta
• SS1

Background

HLA-DRB1 belongs to the HLA class II beta chain paralogs. The class II molecule is a heterodimer consisting of an alpha (DRA) and a beta chain (DRB), both anchored in the membrane. It plays a central role in the immune system by presenting peptides derived from extracellular proteins. Class II molecules are expressed in antigen presenting cells (APC: B lymphocytes, dendritic cells, macrophages). The beta chain is approximately 26-28 kDa. It is encoded by 6 exons. Exon one encodes the leader peptide; exons 2 and 3 encode the two extracellular domains; exon 4 encodes the transmembrane domain; and exon 5 encodes the cytoplasmic tail. Within the DR molecule the beta chain contains all the polymorphisms specifying the peptide binding specificities. Hundreds of DRB1 alleles have been described and typing for these polymorphisms is routinely done for bone marrow and kidney transplantation. DRB1 is expressed at a level five times higher than its paralogs DRB3, DRB4 and DRB5. DRB1 is present in all individuals. Allelic variants of DRB1 are linked with either none or one of the genes DRB3, DRB4 and DRB5. There are 4 related pseudogenes: DRB2, DRB6, DRB7, DRB8 and DRB9. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for HLA DRB1 Antibody (H00003123-B02P)(4)

Publications using H00003123-B02P

• Zhaomin M, Ying T, Juan T et al. Renal mTORC1 activation is associated with disease activity and prognosis in lupus nephritis. Rheumatology (Oxford). 2022-01-18 [PMID: 35040950]
• Shi Y, Jia X, Gu Q et al. A Modified Peptide Derived from Goodpasture Autoantigen Arrested and Attenuated Kidney Injuries in a Rat Model of Anti-GBM Glomerulonephritis. J Am Soc Nephrol. 2019-10-30 [PMID: 31666297]
• Gu QH, Jia XY, Li JN et al. The critical amino acids of a nephritogenic epitope on human Goodpasture autoantigen for binding to HLA-DRB1*1501. Mol Immunol 2017-05-29 [PMID: 28570922]
• Cao Y, Schmitz JL, Yang J et al. DRB1*15 Allele Is a Risk Factor for PR3-ANCA Disease in African Americans. J Am Soc Nephrol. 2011-05-26 [PMID: 21617122]

FAQs for HLA DRB1 Antibody (H00003123-B02P). (Showing 1 - 1 of 1 FAQs).

1. We are interested in custom labeling our antibodies to be able to integrate new markers into already existing multicolor FACS panels. We would be glad to receive pricing and general order information for anti-HLA-DRB1 and anti-HLA-DRB5. To estimate expenses for future antibody labeling orders it would be helpful to know on what basis (amount, type, etc.) the price is going to be calculated. Right now the antibodies are still in mouse ascites. Would it be possible to integrate the elution of the antibodies from the ascites before labeling as part of the service agreement?
   • While we do not generally do this kind of custom purification unless it is for very large amounts of antibody, we do have a number of kits available that may be of use to you. Since an antibody that is still in ascites can not be labeled, it will need to be purified. A list of our kits available for this can be found at the following link: AbSelect. Once the antibodies are purified, they can be labeled with any number of different colors. A list of these kits for labeling can be found at the following link: Lightning-Link.

Bioinformatics

• Gene Symbol: HLA-DRB1
• Entrez:
  • 3123(Human)
• Uniprot:
  • AAH33827.1(Human)